PDB entry 6e5t

View 6e5t on RCSB PDB site
Description: Crystal structure of human cellular retinol binding protein 1 in complex with abnormal-cannabidiorcin (Abn-CBDO)
Class: lipid binding protein
Keywords: vitamin A, retinol, abn-CBDO, abnormal cannabidiorcin, LIPID BINDING PROTEIN
Deposited on 2018-07-23, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinol-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP1, CRBP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09455 (0-133)
      • expression tag (134-138)
    Domains in SCOPe 2.07: d6e5ta1, d6e5ta2
  • Heterogens: HVJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e5tA (A:)
    pvdftgywkmlvnenfeeylraldvnvalrkianllkpdkeivqdgdhmiirtlstfrny
    imdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlemr
    vegvvckqvfkkvqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5tA (A:)
    pvdftgywkmlvnenfeeylraldvnvalrkianllkpdkeivqdgdhmiirtlstfrny
    imdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlemr
    vegvvckqvfkkvqhhhhh