PDB entry 6e5b

View 6e5b on RCSB PDB site
Description: Human Immunoproteasome 20S particle in complex with compound 1
Class: hydrolase
Keywords: multicatalytic proteinase, 20s proteasome, protease, proteros, proteros biostructures gmbh, hydrolase
Deposited on 2018-07-19, released 2019-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-09-11, with a file datestamp of 2019-09-06.
Experiment type: XRAY
Resolution: 2.77 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteasome subunit alpha type-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Proteasome subunit alpha type-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Proteasome subunit alpha type-7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5bc_
  • Chain 'D':
    Compound: Proteasome subunit alpha type-5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5bd_
  • Chain 'E':
    Compound: Proteasome subunit alpha type-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5be_
  • Chain 'F':
    Compound: Proteasome subunit alpha type-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5bf_
  • Chain 'G':
    Compound: Proteasome subunit alpha type-6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5bg_
  • Chain 'H':
    Compound: Proteasome subunit beta type-10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5bh_
  • Chain 'I':
    Compound: Proteasome subunit beta type-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5bi_
  • Chain 'J':
    Compound: Proteasome subunit beta type-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5bj_
  • Chain 'K':
    Compound: Proteasome subunit beta type-8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5bk_
  • Chain 'L':
    Compound: Proteasome subunit beta type-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5bl_
  • Chain 'M':
    Compound: Proteasome subunit beta type-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5bm_
  • Chain 'N':
    Compound: Proteasome subunit beta type-9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5bn_
  • Chain 'O':
    Compound: Proteasome subunit alpha type-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5bo_
  • Chain 'P':
    Compound: Proteasome subunit alpha type-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5bp_
  • Chain 'Q':
    Compound: Proteasome subunit alpha type-7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5bq_
  • Chain 'R':
    Compound: Proteasome subunit alpha type-5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5br_
  • Chain 'S':
    Compound: Proteasome subunit alpha type-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5bs_
  • Chain 'T':
    Compound: Proteasome subunit alpha type-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5bt_
  • Chain 'U':
    Compound: Proteasome subunit alpha type-6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5bu_
  • Chain 'V':
    Compound: Proteasome subunit beta type-10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5bv_
  • Chain 'W':
    Compound: Proteasome subunit beta type-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5bw_
  • Chain 'X':
    Compound: Proteasome subunit beta type-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5bx_
  • Chain 'Y':
    Compound: Proteasome subunit beta type-8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5by_
  • Chain 'Z':
    Compound: Proteasome subunit beta type-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5bz_
  • Chain 'a':
    Compound: Proteasome subunit beta type-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5ba_
  • Chain 'b':
    Compound: Proteasome subunit beta type-9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5bb_
  • Heterogens: HUJ, SCN, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6e5bC (C:)
    msydraitvfspdghlfqveyaqeavkkgstavgvrgrdivvlgvekksvaklqdertvr
    kicalddnvcmafagltadarivinrarvecqshrltvedpvtveyitryiaslkqrytq
    sngrrpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvrefleknytdea
    ietddltiklvikallevvqsggknielavmrrdqslkilnpeeiekyvaeiekekeene
    kkkqkkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bC (C:)
    sydraitvfspdghlfqveyaqeavkkgstavgvrgrdivvlgvekaklqdertvrkica
    lddnvcmafagltadarivinrarvecqshrltvedpvtveyitryiaslkqrytqsngr
    rpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvrefleknytdeaietd
    dltiklvikallevvknielavmrrdqslkilnpeeiekyvaeieke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6e5bD (D:)
    mfltrseydrgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplme
    pssiekiveidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnla
    lqfgeedadpgamsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqss
    lqevyhksmtlkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikd
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bD (D:)
    drgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplmepssiekiv
    eidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnlalqfgeeda
    damsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqsslqevyhksmt
    lkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6e5bE (E:)
    mfrnqydndvtvwspqgrihqieyameavkqgsatvglkskthavlvalkraqselaahq
    kkilhvdnhigisiagltadarllcnfmrqecldsrfvfdrplpvsrlvsligsktqipt
    qrygrrpygvglliagyddmgphifqtcpsanyfdcramsigarsqsartylerhmsefm
    ecnlnelvkhglralretlpaeqdlttknvsigivgkdleftiyddddvspflegleerp
    qrkaqpaqpadepaekadepmeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bE (E:)
    nqydndvtvwspqgrihqieyameavkqgsatvglkskthavlvalkraqselaahqkki
    lhvdnhigisiagltadarllcnfmrqecldsrfvfdrplpvsrlvsligsktqiptqry
    grrpygvglliagyddmgphifqtcpsanyfdcramsigarsqsartylerhmsefmecn
    lnelvkhglralretlpaeqdlttknvsigivgkdleftiyddddvspflegleer
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6e5bF (F:)
    mssigtgydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklye
    egsnkrlfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyv
    haytlysavrpfgcsfmlgsysvndgaqlymidpsgvsygywgcaigkarqaakteiekl
    qmkemtcrdivkevakiiyivhdevkdkafelelswvgeltngrheivpkdireeaekya
    keslkeedesdddnm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bF (F:)
    gtgydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklyeegsn
    krlfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyvhayt
    lysavrpfgcsfmlgsysvndgaqlymidpsgvsygywgcaigkarqaakteieklqmke
    mtcrdivkevakiiyivhdevkdkafelelswvgeltngrheivpkdireeaekyakesl
    keed
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6e5bG (G:)
    msrgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdcavivtqkkvpdkl
    ldsstvthlfkitenigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriad
    isqvytqnaemrplgccmiligideeqgpqvykcdpagyycgfkataagvkqtestsfle
    kkvkkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlv
    alaerd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bG (G:)
    gssagfdrhitifspegrlyqveyafkainqggltsvavrgkdcavivtqkkvpdkllds
    stvthlfkitenigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriadisq
    vytqnaemrplgccmiligideeqgpqvykcdpagyycgfkataagvkqtestsflekkv
    kkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlvala
    e
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6e5bH (H:)
    mlkpaleprggfsfencqrnaslervlpglkvpharktgttiaglvfqdgvilgadtrat
    ndsvvadkscekihfiapkiyccgagvaadaemttrmvaskmelhalstgreprvatvtr
    ilrqtlfryqghvgaslivggvdltgpqlygvhphgsysrlpftalgsgqdaalavledr
    fqpnmtleaaqgllveavtagilgdlgsggnvdacvitktgakllrtlssptepvkrsgr
    yhfvpgttavltqtvkpltlelveetvqameve
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bH (H:)
    ttiaglvfqdgvilgadtratndsvvadkscekihfiapkiyccgagvaadaemttrmva
    skmelhalstgreprvatvtrilrqtlfryqghvgaslivggvdltgpqlygvhphgsys
    rlpftalgsgqdaalavledrfqpnmtleaaqgllveavtagilgdlgsggnvdacvitk
    tgakllrtlssptersgryhfvpgttavltqtvkpltl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6e5bI (I:)
    msimsynggavmamkgkncvaiaadrrfgiqaqmvttdfqkifpmgdrlyiglaglatdv
    qtvaqrlkfrlnlyelkegrqikpytlmsmvanllyekrfgpyytepviagldpktfkpf
    icsldligcpmvtddfvvsgtcaeqmygmceslwepnmdpdhlfetisqamlnavdrdav
    sgmgvivhiiekdkittrtlkarmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bI (I:)
    simsynggavmamkgkncvaiaadrrfgiqaqmvttdfqkifpmgdrlyiglaglatdvq
    tvaqrlkfrlnlyelkegrqikpytlmsmvanllyekrfgpyytepviagldpktfkpfi
    csldligcpmvtddfvvsgtcaeqmygmceslwepnmdpdhlfetisqamlnavdrdavs
    gmgvivhiiekdkittrtlkarmd
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6e5bJ (J:)
    meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi
    qknvqlykmrngyelsptaaanftrrnladclrsrtpyhvnlllagydehegpalyymdy
    laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv
    riidkngihdldnisfpkqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bJ (J:)
    meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi
    qknvqlykmrngyelsptaaanftrrnladclrsrtpyhvnlllagydehegpalyymdy
    laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv
    riidkngihdldnisf
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6e5bK (K:)
    malldvcgaprgqrpesalpvagsgrrsdpghysfsmrspelalprgmqpteffqslggd
    gernvqiemahgtttlafkfqhgviaavdsrasagsyisalrvnkvieinpyllgtmsgc
    aadcqywerllakecrlyylrngerisvsaaskllsnmmcqyrgmglsmgsmicgwdkkg
    pglyyvdehgtrlsgnmfstgsgntyaygvmdsgyrpnlspeeaydlgrraiayathrds
    ysggvvnmyhmkedgwvkvestdvsdllhqyreanq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bK (K:)
    tttlafkfqhgviaavdsrasagsyisalrvnkvieinpyllgtmsgcaadcqywerlla
    kecrlyylrngerisvsaaskllsnmmcqyrgmglsmgsmicgwdkkgpglyyvdehgtr
    lsgnmfstgsgntyaygvmdsgyrpnlspeeaydlgrraiayathrdsysggvvnmyhmk
    edgwvkvestdvsdllhqyrean
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6e5bL (L:)
    mlsstamysapgrdlgmephraagplqlrfspyvfnggtilaiagedfaivasdtrlseg
    fsihtrdspkcykltdktvigcsgfhgdcltltkiiearlkmykhsnnkamttgaiaaml
    stilysrrffpyyvyniiggldeegkgavysfdpvgsyqrdsfkaggsasamlqplldnq
    vgfknmqnvehvplsldramrlvkdvfisaaerdvytgdalricivtkegireetvslrk
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bL (L:)
    rfspyvfnggtilaiagedfaivasdtrlsegfsihtrdspkcykltdktvigcsgfhgd
    cltltkiiearlkmykhsnnkamttgaiaamlstilysrrffpyyvyniiggldeegkga
    vysfdpvgsyqrdsfkaggsasamlqplldnqvgfknmqnvehvplsldramrlvkdvfi
    saaerdvytgdalricivtkegireetvslrkd
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6e5bM (M:)
    meaflgsrsglwaggpapgqfyripstpdsfmdpasalyrgpitrtqnpmvtgtsvlgvk
    feggvviaadmlgsygslarfrnisrimrvnnstmlgasgdyadfqylkqvlgqmvidee
    llgdghsyspraihswltramysrrskmnplwntmviggyadgesflgyvdmlgvayeap
    slatgygaylaqpllrevlekqpvlsqteardlvercmrvlyyrdarsynrfqiatvtek
    gveiegplstetnwdiahmisgfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bM (M:)
    tqnpmvtgtsvlgvkfeggvviaadmlgsygslarfrnisrimrvnnstmlgasgdyadf
    qylkqvlgqmvideellgdghsyspraihswltramysrrskmnplwntmviggyadges
    flgyvdmlgvayeapslatgygaylaqpllrevlekqpvlsqteardlvercmrvlyyrd
    arsynrfqiatvtekgveiegplstetnwdiahm
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >6e5bN (N:)
    mlragaptgdlpragevhtgttimavefdggvvmgsdsrvsageavvnrvfdklsplher
    iycalsgsaadaqavadmaayqlelhgieleepplvlaaanvvrnisykyredlsahlmv
    agwdqreggqvygtlggmltrqpfaiggsgstfiygyvdaaykpgmspeecrrfttdaia
    lamsrdgssggviylvtitaagvdhrvilgnelpkfyde
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bN (N:)
    ttimavefdggvvmgsdsrvsageavvnrvfdklsplheriycalsgsaadaqavadmaa
    yqlelhgieleepplvlaaanvvrnisykyredlsahlmvagwdqreggqvygtlggmlt
    rqpfaiggsgstfiygyvdaaykpgmspeecrrfttdaialamsrdgssggviylvtita
    agvdhrvilgnelpkfyde
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >6e5bO (O:)
    maergysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilyder
    svhkvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqe
    ytqsggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekryne
    dleledaihtailtlkesfegqmtednievgicneagfrrltptevkdylaaia
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bO (O:)
    gysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilydersvhk
    vepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqeytqs
    ggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekrynedlel
    edaihtailtlkesfegqmtednievgicneagfrrltptevkdylaai
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >6e5bP (P:)
    msrrydsrttifspegrlyqveyameaighagtclgilandgvllaaerrnihklldevf
    fsekiyklnedmacsvagitsdanvltnelrliaqryllqyqepipceqlvtalcdikqa
    ytqfggkrpfgvsllyigwdkhygfqlyqsdpsgnyggwkatcignnsaaavsmlkqdyk
    egemtlksalalaikvlnktmdvsklsaekveiatltrengktvirvlkqkeveqlikkh
    eeeeakaerekkekeqkekdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bP (P:)
    srrydsrttifspegrlyqveyameaighagtclgilandgvllaaerrnihklldevff
    sekiyklnedmacsvagitsdanvltnelrliaqryllqyqepipceqlvtalcdikqay
    tqfggkrpfgvsllyigwdkhygfqlyqsdpsgnyggwkatcignnsaaavsmlkqdyke
    gemtlksalalaikvlnktmdlsaekveiatltrengktvirvlkqkeveqlikkheeee
    akaere
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >6e5bQ (Q:)
    msydraitvfspdghlfqveyaqeavkkgstavgvrgrdivvlgvekksvaklqdertvr
    kicalddnvcmafagltadarivinrarvecqshrltvedpvtveyitryiaslkqrytq
    sngrrpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvrefleknytdea
    ietddltiklvikallevvqsggknielavmrrdqslkilnpeeiekyvaeiekekeene
    kkkqkkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bQ (Q:)
    sydraitvfspdghlfqveyaqeavkkgstavgvrgrdivvlgvekaklqdertvrkica
    lddnvcmafagltadarivinrarvecqshrltvedpvtveyitryiaslkqrytqsngr
    rpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvrefleknytdeaietd
    dltiklvikallevvqsggknielavmrrdqslkilnpeeiekyvaeiekekee
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >6e5bR (R:)
    mfltrseydrgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplme
    pssiekiveidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnla
    lqfgeedadpgamsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqss
    lqevyhksmtlkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikd
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bR (R:)
    drgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplmepssiekiv
    eidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnlalqfgeeda
    dpgamsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqsslqevyhks
    mtlkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikd
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >6e5bS (S:)
    mfrnqydndvtvwspqgrihqieyameavkqgsatvglkskthavlvalkraqselaahq
    kkilhvdnhigisiagltadarllcnfmrqecldsrfvfdrplpvsrlvsligsktqipt
    qrygrrpygvglliagyddmgphifqtcpsanyfdcramsigarsqsartylerhmsefm
    ecnlnelvkhglralretlpaeqdlttknvsigivgkdleftiyddddvspflegleerp
    qrkaqpaqpadepaekadepmeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bS (S:)
    nqydndvtvwspqgrihqieyameavkqgsatvglkskthavlvalkraqselaahqkki
    lhvdnhigisiagltadarllcnfmrqecldsrfvfdrplpvsrlvsligsktqiptqry
    grrpygvglliagyddmgphifqtcpsanyfdcramsigarsqsartylerhmsefmecn
    lnelvkhglralretlpaeqdlttknvsigivgkdleftiyddddvspflegleer
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >6e5bT (T:)
    mssigtgydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklye
    egsnkrlfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyv
    haytlysavrpfgcsfmlgsysvndgaqlymidpsgvsygywgcaigkarqaakteiekl
    qmkemtcrdivkevakiiyivhdevkdkafelelswvgeltngrheivpkdireeaekya
    keslkeedesdddnm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bT (T:)
    gtgydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklyeegsn
    krlfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyvhayt
    lysavrpfgcsfmlgsysvndgaqlymidpsgvsygywgcaigkarqaakteieklqmke
    mtcrdivkevakiiyivhdevkdkafelelswvgeltngrheivpkdireeaekyakesl
    k
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >6e5bU (U:)
    msrgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdcavivtqkkvpdkl
    ldsstvthlfkitenigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriad
    isqvytqnaemrplgccmiligideeqgpqvykcdpagyycgfkataagvkqtestsfle
    kkvkkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlv
    alaerd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bU (U:)
    gssagfdrhitifspegrlyqveyafkainqggltsvavrgkdcavivtqkkvpdkllds
    stvthlfkitenigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriadisq
    vytqnaemrplgccmiligideeqgpqvykcdpagyycgfkataagvkqtestsflekkv
    kkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlvala
    er
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >6e5bV (V:)
    mlkpaleprggfsfencqrnaslervlpglkvpharktgttiaglvfqdgvilgadtrat
    ndsvvadkscekihfiapkiyccgagvaadaemttrmvaskmelhalstgreprvatvtr
    ilrqtlfryqghvgaslivggvdltgpqlygvhphgsysrlpftalgsgqdaalavledr
    fqpnmtleaaqgllveavtagilgdlgsggnvdacvitktgakllrtlssptepvkrsgr
    yhfvpgttavltqtvkpltlelveetvqameve
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bV (V:)
    ttiaglvfqdgvilgadtratndsvvadkscekihfiapkiyccgagvaadaemttrmva
    skmelhalstgreprvatvtrilrqtlfryqghvgaslivggvdltgpqlygvhphgsys
    rlpftalgsgqdaalavledrfqpnmtleaaqgllveavtagilgdlgsggnvdacvitk
    tgakllrtlssptersgryhfvpgttavltqtvkpltl
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >6e5bW (W:)
    msimsynggavmamkgkncvaiaadrrfgiqaqmvttdfqkifpmgdrlyiglaglatdv
    qtvaqrlkfrlnlyelkegrqikpytlmsmvanllyekrfgpyytepviagldpktfkpf
    icsldligcpmvtddfvvsgtcaeqmygmceslwepnmdpdhlfetisqamlnavdrdav
    sgmgvivhiiekdkittrtlkarmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bW (W:)
    simsynggavmamkgkncvaiaadrrfgiqaqmvttdfqkifpmgdrlyiglaglatdvq
    tvaqrlkfrlnlyelkegrqikpytlmsmvanllyekrfgpyytepviagldpktfkpfi
    csldligcpmvtddfvvsgtcaeqmygmceslwepnmdpdhlfetisqamlnavdrdavs
    gmgvivhiiekdkittrtlkarmd
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >6e5bX (X:)
    meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi
    qknvqlykmrngyelsptaaanftrrnladclrsrtpyhvnlllagydehegpalyymdy
    laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv
    riidkngihdldnisfpkqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bX (X:)
    meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi
    qknvqlykmrngyelsptaaanftrrnladclrsrtpyhvnlllagydehegpalyymdy
    laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv
    riidkngihdldnisfp
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >6e5bY (Y:)
    malldvcgaprgqrpesalpvagsgrrsdpghysfsmrspelalprgmqpteffqslggd
    gernvqiemahgtttlafkfqhgviaavdsrasagsyisalrvnkvieinpyllgtmsgc
    aadcqywerllakecrlyylrngerisvsaaskllsnmmcqyrgmglsmgsmicgwdkkg
    pglyyvdehgtrlsgnmfstgsgntyaygvmdsgyrpnlspeeaydlgrraiayathrds
    ysggvvnmyhmkedgwvkvestdvsdllhqyreanq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bY (Y:)
    tttlafkfqhgviaavdsrasagsyisalrvnkvieinpyllgtmsgcaadcqywerlla
    kecrlyylrngerisvsaaskllsnmmcqyrgmglsmgsmicgwdkkgpglyyvdehgtr
    lsgnmfstgsgntyaygvmdsgyrpnlspeeaydlgrraiayathrdsysggvvnmyhmk
    edgwvkvestdvsdllhqyrean
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >6e5bZ (Z:)
    mlsstamysapgrdlgmephraagplqlrfspyvfnggtilaiagedfaivasdtrlseg
    fsihtrdspkcykltdktvigcsgfhgdcltltkiiearlkmykhsnnkamttgaiaaml
    stilysrrffpyyvyniiggldeegkgavysfdpvgsyqrdsfkaggsasamlqplldnq
    vgfknmqnvehvplsldramrlvkdvfisaaerdvytgdalricivtkegireetvslrk
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bZ (Z:)
    rfspyvfnggtilaiagedfaivasdtrlsegfsihtrdspkcykltdktvigcsgfhgd
    cltltkiiearlkmykhsnnkamttgaiaamlstilysrrffpyyvyniiggldeegkga
    vysfdpvgsyqrdsfkaggsasamlqplldnqvgfknmqnvehvplsldramrlvkdvfi
    saaerdvytgdalricivtkegireetvslrkd
    

  • Chain 'a':
    Sequence, based on SEQRES records: (download)
    >6e5ba (a:)
    meaflgsrsglwaggpapgqfyripstpdsfmdpasalyrgpitrtqnpmvtgtsvlgvk
    feggvviaadmlgsygslarfrnisrimrvnnstmlgasgdyadfqylkqvlgqmvidee
    llgdghsyspraihswltramysrrskmnplwntmviggyadgesflgyvdmlgvayeap
    slatgygaylaqpllrevlekqpvlsqteardlvercmrvlyyrdarsynrfqiatvtek
    gveiegplstetnwdiahmisgfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5ba (a:)
    tqnpmvtgtsvlgvkfeggvviaadmlgsygslarfrnisrimrvnnstmlgasgdyadf
    qylkqvlgqmvideellgdghsyspraihswltramysrrskmnplwntmviggyadges
    flgyvdmlgvayeapslatgygaylaqpllrevlekqpvlsqteardlvercmrvlyyrd
    arsynrfqiatvtekgveiegplstetnwdiahm
    

  • Chain 'b':
    Sequence, based on SEQRES records: (download)
    >6e5bb (b:)
    mlragaptgdlpragevhtgttimavefdggvvmgsdsrvsageavvnrvfdklsplher
    iycalsgsaadaqavadmaayqlelhgieleepplvlaaanvvrnisykyredlsahlmv
    agwdqreggqvygtlggmltrqpfaiggsgstfiygyvdaaykpgmspeecrrfttdaia
    lamsrdgssggviylvtitaagvdhrvilgnelpkfyde
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5bb (b:)
    ttimavefdggvvmgsdsrvsageavvnrvfdklsplheriycalsgsaadaqavadmaa
    yqlelhgieleepplvlaaanvvrnisykyredlsahlmvagwdqreggqvygtlggmlt
    rqpfaiggsgstfiygyvdaaykpgmspeecrrfttdaialamsrdgssggviylvtita
    agvdhrvilgnelpkfyde