PDB entry 6e56

View 6e56 on RCSB PDB site
Description: Human antibody H2214 in complex with influenza hemagglutinin A/Aichi/2/1968 (X-31) (H3N2)
Class: viral protein/immune system
Keywords: influenza antibody, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2018-07-19, released 2019-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:387139]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03437
      • conflict (151)
    Domains in SCOPe 2.07: d6e56a_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:387139]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03437
      • conflict (151)
    Domains in SCOPe 2.07: d6e56d_
  • Chain 'G':
    Compound: antibody H2214 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHV3-23*01
    Database cross-references and differences (RAF-indexed):
    • PDB 6E56 (0-End)
  • Chain 'H':
    Compound: antibody H2214 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHV3-23*01
    Database cross-references and differences (RAF-indexed):
    • PDB 6E56 (0-End)
  • Chain 'I':
    Compound: antibody H2214 light chain, K1642
    Species: Homo sapiens [TaxId:9606]
    Gene: IGKV3-15*01
    Database cross-references and differences (RAF-indexed):
    • PDB 6E56 (0-105)
    • Uniprot Q6PIL8 (106-End)
    Domains in SCOPe 2.07: d6e56i1, d6e56i2
  • Chain 'J':
    Compound: antibody H2214 light chain, K1642
    Species: Homo sapiens [TaxId:9606]
    Gene: IGKV3-15*01
    Database cross-references and differences (RAF-indexed):
    • PDB 6E56 (0-105)
    • Uniprot Q6PIL8 (106-End)
    Domains in SCOPe 2.07: d6e56j1, d6e56j2
  • Heterogens: NAG, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e56A (A:)
    tnatelvqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsn
    cypydvpdyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltk
    sgstypvlnvtmpnndnfdklyiwgihhpstdqeqtslyvqasgrvtvstrrsqqtiipn
    igsrpwvrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidt
    cisecitpngsipndkpfqnvnkitygacpkyvkqntlklatgglevlfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e56A (A:)
    telvqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncyp
    ydvpdyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltksgs
    typvlnvtmpnndnfdklyiwgihhpstdqeqtslyvqasgrvtvstrrsqqtiipnigs
    rpwvrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtcis
    ecitpngsipndkpfqnvnkitygacpkyvkq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6e56D (D:)
    tnatelvqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsn
    cypydvpdyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltk
    sgstypvlnvtmpnndnfdklyiwgihhpstdqeqtslyvqasgrvtvstrrsqqtiipn
    igsrpwvrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidt
    cisecitpngsipndkpfqnvnkitygacpkyvkqntlklatgglevlfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e56D (D:)
    telvqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncyp
    ydvpdyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltksgs
    typvlnvtmpnndnfdklyiwgihhpstdqeqtslyvqasgrvtvstrrsqqtiipnigs
    rpwvrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtcis
    ecitpngsipndkpfqnvnkitygacpkyvkqn
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6e56I (I:)
    eivmtqspdtlsvspgeratlscrasesissnlawyqqkpgqvprlliygastratgvpa
    rftgsgsgteftltisslqsedfavyycqqynnrlpytfgqgtkleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e56I (I:)
    eivmtqspdtlsvspgeratlscrasesissnlawyqqkpgqvprlliygastratgvpa
    rftgsgsgteftltisslqsedfavyycqqynnrlpytfgqgtkleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6e56J (J:)
    eivmtqspdtlsvspgeratlscrasesissnlawyqqkpgqvprlliygastratgvpa
    rftgsgsgteftltisslqsedfavyycqqynnrlpytfgqgtkleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e56J (J:)
    eivmtqspdtlsvspgeratlscrasesissnlawyqqkpgqvprlliygastratgvpa
    rftgsgsgteftltisslqsedfavyycqqynnrlpytfgqgtkleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnr