PDB entry 6e4x

View 6e4x on RCSB PDB site
Description: Human antibody S5V2-29 in complex with influenza hemagglutinin A/Texas/50/2012 (H3N2)
Class: viral protein/immune system
Keywords: influenza antibody, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2018-07-18, released 2019-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Texas/50/2012(H3N2)) [TaxId:1321009]
    Gene: HA, L998_47834gpHA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e4xb_
  • Chain 'Y':
    Compound: S5V2-29 light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGKV1-39*01
    Database cross-references and differences (RAF-indexed):
    • PDB 6E4X (0-91)
    • Uniprot Q8TCD0 (92-End)
    Domains in SCOPe 2.07: d6e4xy1, d6e4xy2
  • Chain 'Z':
    Compound: S5V2-29 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHV4-61*01
    Database cross-references and differences (RAF-indexed):
    • PDB 6E4X (0-End)
  • Heterogens: NAG, BMA, MAN, FUC, GOL, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6e4xB (B:)
    tnatelvqnssigeicdsphqildgenctlidallgdpqcdgfqnkkwdlfverskaysn
    cypydvpdyaslrslvassgtlefnnesfnwngvtqngtssacirrsnnsffsrlnwlth
    lnfkypalnvtmpnneqfdklyiwgvhhpvtdkdqiflyaqpsgritvstkrsqqavipn
    igfrprirnipsrisiywtivkpgdillinstgnliaprgyfkirsgkssimrsdapigk
    cksecitpngsipndkpfqnvnritygacpryvkqstlklatggalevlfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e4xB (B:)
    tnatelvqnssigeicdsphqildgenctlidallgdpqcdgfqnkkwdlfverskaysn
    cypydvpdyaslrslvassgtlefnnesfnwngvtqngtssacirrsnnsffsrlnwlth
    lnfkypalnvtmpnneqfdklyiwgvhhpvtdkdqiflyaqpsgritvstkrsqqavipn
    igfrprirnipsrisiywtivkpgdillinstgnliaprgyfkirsgkssimrsdapigk
    cksecitpngsipndkpfqnvnritygacpryvkq
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >6e4xY (Y:)
    diqmtqtpsslsasvgdrvtitcrasqsigaslnwyqqkpgeapkfliyaasnlqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqqgtfgqgtkleikrtvaapsvfifppsdeq
    lksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlska
    dyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e4xY (Y:)
    diqmtqtpsslsasvgdrvtitcrasqsigaslnwyqqkpgeapkfliyaasnlqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqqgtfgqgtkleikrtvaapsvfifppsdeq
    lksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlska
    dyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'Z':
    No sequence available.