PDB entry 6e4v

View 6e4v on RCSB PDB site
Description: The Crystal Structure of FhuE from E. coli in complex with its substrate Coprogen
Class: transport protein
Keywords: TonB-Dependent Transporter, Coprogen, Gram-negative bacteria, outer membrane, Iron Transport, TRANSPORT PROTEIN
Deposited on 2018-07-18, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FhuE receptor
    Species: Escherichia coli BW25113 [TaxId:679895]
    Gene: fhuE, b1102, JW1088
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e4va_
  • Heterogens: BOG, HWS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e4vA (A:)
    apateetvivegsatapddgendysvtstsagtkmqmtqrdipqsvtivsqqrmedqqlq
    tlgevmentlgisksqadsdralyysrgfqidnymvdgiptyfesrwnlgdalsdmalfe
    rvevvrgatglmtgtgnpsaainmvrkhatsrefkgdvsaeygswnkeryvadlqsplte
    dgkirarivggyqnndswldrynsektffsgivdadlgdlttlsagyeyqridvnsptwg
    glprwntdgssnsydrarstapdwayndkeinkvfmtlkqqfadtwqatlnathsevefd
    skmmyvdayvnkadgmlvgpysnygpgfdyvggtgwnsgkrkvdaldlfadgsyelfgrq
    hnlmfggsyskqnnryfsswanifpdeigsfynfngnfpqtdwspqslaqddtthmksly
    aatrvtladplhlilgarytnwrvdtltysmeknhttpyaglvfdindnwstyasytsif
    qpqndrdssgkylapitgnnyelglksdwmnsrltttlaifrieqdnvaqstgtpipgsn
    getaykavdgtvskgvefelngaitdnwqltfgatryiaednegnavnpnlprttvkmft
    syrlpvmpeltvgggvnwqnrvytdtvtpygtfraeqgsyalvdlftryqvtknfslqgn
    vnnlfdktydtnvegsivygtprnfsitgtyqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e4vA (A:)
    ndysvtstsagtkmqmtqrdipqsvtivsqqrmedqqlqtlgevmentlgisksqadsdr
    alyysrgfqidnymvdgiptyfesrwnlgdalsdmalfervevvrgatglmtgtgnpsaa
    inmvrkhatsrefkgdvsaeygswnkeryvadlqspltedgkirarivggyqnndswldr
    ynsektffsgivdadlgdlttlsagyeyqridvnsptwgglprwntdgssnsydrarsta
    pdwayndkeinkvfmtlkqqfadtwqatlnathsevefdskmmyvdayvnkadgmlvgpy
    snygpgfdyvggtgwnsgkrkvdaldlfadgsyelfgrqhnlmfggsyskqnnryfsswa
    nifpdeigsfynfngnfpqtdwspqslaqddtthmkslyaatrvtladplhlilgarytn
    wrvdtltysmeknhttpyaglvfdindnwstyasytsifqpqndrdssgkylapitgnny
    elglksdwmnsrltttlaifrieqdnvaqstgtpipgsngetaykavdgtvskgvefeln
    gaitdnwqltfgatryiaednegnavnpnlprttvkmftsyrlpvmpeltvgggvnwqnr
    vytdtvtpygtfraeqgsyalvdlftryqvtknfslqgnvnnlfdktydtnvegsivygt
    prnfsitgtyqf