PDB entry 6e4l

View 6e4l on RCSB PDB site
Description: The structure of the N-terminal domain of human clathrin heavy chain 1 (nTD) in complex with ES9
Class: endocytosis
Keywords: Clathrin-mediated endocytosis (CME), Clathrin N-terminal domain (nTD), chemical inhibition, ENDOCYTOSIS
Deposited on 2018-07-17, released 2019-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-29, with a file datestamp of 2019-05-24.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Clathrin heavy chain 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CLTC, CLH17, CLTCL2, KIAA0034
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00610 (5-End)
      • expression tag (4)
    Domains in SCOPe 2.08: d6e4la1, d6e4la2, d6e4la3
  • Heterogens: DMS, GOL, EDO, ACT, HRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e4lA (A:)
    gspefmaqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidm
    ndpsnpirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwis
    lntvalvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqn
    rvvgamqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgt
    pptgnqpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciym
    nrisgetifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrn
    nlagaeelf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e4lA (A:)
    fmaqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndps
    npirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntv
    alvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvg
    amqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptg
    nqpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnris
    getifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnl