PDB entry 6e4f

View 6e4f on RCSB PDB site
Description: Crystal structure of ARQ 531 in complex with the kinase domain of BTK
Class: SIGNALING PROTEIN/inhibitor
Keywords: inhibitor, complex, SIGNALING PROTEIN, SIGNALING PROTEIN-inhibitor complex
Deposited on 2018-07-17, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Gene: BTK, AGMX1, ATK, BPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e4fa_
  • Heterogens: HRA, IMD, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e4fA (A:)
    mhhhhhhgggenlyfqgtaglgygsweidpkdltflkelgtgqfgvvkygkwrgqydvai
    kmikegsmsedefieeakvmmnlsheklvqlygvctkqrpifiiteymangcllnylrem
    rhrfqtqqllemckdvceameyleskqflhrdlaarnclvndqgvvkvsdfglsryvldd
    eytssvgskfpvrwsppevlmyskfssksdiwafgvlmweiyslgkmpyerftnsetaeh
    iaqglrlyrphlasekvytimyscwhekaderptfkillsnildvmdees
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e4fA (A:)
    glgygsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakv
    mmnlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvcea
    meyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppev
    lmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvyt
    imyscwhekaderptfkillsnildvmdee