PDB entry 6e4e

View 6e4e on RCSB PDB site
Description: Crystal structure of dihydrofolate reductase from Staphylococcus aureus MW2 bound to NADP and p218
Class: OXIDOREDUCTASE/Inhibitor
Keywords: NIAID, DHFR, folate, folic acid, MMV, inhibitor, malaria, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, OXIDOREDUCTASE, OXIDOREDUCTASE-Inhibitor complex
Deposited on 2018-07-17, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e4ea_
  • Heterogens: NAP, MMV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e4eA (A:)
    mgsshhhhhhssglvprgshmasmtlsilvahdlqrvigfenqlpwhlpndlkhvkklst
    ghtlvmgrktfesigkplpnrrnvvltsdtsfnvegvdvihsiediyqlpghvfifggqt
    lfeemidkvddmyitviegkfrgdtffppytfedwevassvegkldekntiphtflhlir
    kk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e4eA (A:)
    mtlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrn
    vvltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrg
    dtffppytfedwevassvegkldekntiphtflhlirkk