PDB entry 6e49

View 6e49 on RCSB PDB site
Description: Pif1 peptide bound to PCNA trimer
Class: DNA binding protein
Keywords: Complex, PCNA, Pif1 peptide, DNA BINDING PROTEIN
Deposited on 2018-07-17, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: POL30, YBR088C, YBR0811
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e49a1, d6e49a2
  • Chain 'B':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: POL30, YBR088C, YBR0811
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e49b1, d6e49b2
  • Chain 'C':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: POL30, YBR088C, YBR0811
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e49c1, d6e49c2
  • Chain 'D':
    Compound: ATP-dependent DNA helicase PIF1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: PIF1, TST1, YML061C, YM9958.01C
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: ATP-dependent DNA helicase PIF1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: PIF1, TST1, YML061C, YM9958.01C
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: ATP-dependent DNA helicase PIF1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: PIF1, TST1, YML061C, YM9958.01C
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e49A (A:)
    mgsshhhhhhsqdpmleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvl
    lvsleigveafqeyrcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedt
    kkdriaeyslklmdidadflkieelqydstlslpssefskivrdlsqlsdsinimitket
    ikfvadgdigsgsviikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvg
    irlsseapalfqfdlksgflqfflapkfndee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e49A (A:)
    mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
    rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
    idadflkieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsv
    iikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfd
    lksgflqfflapkfn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6e49B (B:)
    mgsshhhhhhsqdpmleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvl
    lvsleigveafqeyrcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedt
    kkdriaeyslklmdidadflkieelqydstlslpssefskivrdlsqlsdsinimitket
    ikfvadgdigsgsviikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvg
    irlsseapalfqfdlksgflqfflapkfndee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e49B (B:)
    mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
    rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
    idadflkieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsv
    iikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfd
    lksgflqfflapkfn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6e49C (C:)
    mgsshhhhhhsqdpmleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvl
    lvsleigveafqeyrcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedt
    kkdriaeyslklmdidadflkieelqydstlslpssefskivrdlsqlsdsinimitket
    ikfvadgdigsgsviikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvg
    irlsseapalfqfdlksgflqfflapkfndee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e49C (C:)
    mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
    rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
    idadflkieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsv
    iikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfd
    lksgflqfflapkf
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.