PDB entry 6e3n

View 6e3n on RCSB PDB site
Description: The N-terminal domain of PA endonuclease from the influenza H1N1 virus in complex with 3-hydroxy-4-oxo-6-(o-tolyl)-1,4-dihydropyridine-2-carboxylic acid
Class: hydrolase/hydrolase inhibitor
Keywords: PA endonuclease, inhibitor, influenza, H1N1, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2018-07-14, released 2019-07-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-29, with a file datestamp of 2020-01-24.
Experiment type: XRAY
Resolution: 3.19 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polymerase acidic protein
    Species: Influenza A virus [TaxId:641501]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S0 (6-End)
      • expression tag (5)
      • conflict (57)
    Domains in SCOPe 2.08: d6e3na1, d6e3na2
  • Heterogens: MN, HNS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e3nA (A:)
    mgsgmamedfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfgsg
    dpnallkhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrre
    vhiyylekankiksekthihifsftgeematkadytldeesrariktrlftirqemasrs
    lwdsfrqserge
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e3nA (A:)
    amedfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfglkhrfei
    iegrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyylekanki
    ekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqse