PDB entry 6e3h

View 6e3h on RCSB PDB site
Description: Crystal structure of S9-3-37 bound to H5 influenza hemagglutinin
Class: viral protein/immune system
Keywords: Antibody, Influenza virus, hemagglutinin, VIRAL PROTEIN, viral protein-immune system complex
Deposited on 2018-07-14, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin HA1
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5EP31 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d6e3ha1, d6e3ha2
  • Chain 'B':
    Compound: hemagglutinin HA2
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ18 (0-173)
      • expression tag (174)
    Domains in SCOPe 2.07: d6e3hb1, d6e3hb2
  • Chain 'H':
    Compound: antibody S9-3-37 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6E3H (0-End)
  • Chain 'L':
    Compound: antibody S9-3-37 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6E3H (0-218)
    Domains in SCOPe 2.07: d6e3hl1, d6e3hl2
  • Heterogens: NAG, BMA, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e3hA (A:)
    gdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvag
    wllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipk
    sswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgih
    hpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndai
    nfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplti
    gecpkyvksnrlvlatglrnspqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e3hA (A:)
    gdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvag
    wllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipk
    sswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgih
    hpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndai
    nfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplti
    gecpkyvksnrlvlatglrnsp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3hB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeiss
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3hL (L:)
    dvvltqtplsspvtrgqaasiscrssqslvhsdgntylswihqrpgqpprlliykiskrf
    sgvpdrisgsgagteftltisrveaddvgmyyctqasqfprtfgqgtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhklyacevthqglsspvtksfnrgec