PDB entry 6e3g

View 6e3g on RCSB PDB site
Description: Structure of RORgt in complex with a novel agonist.
Class: nuclear protein/agonist
Keywords: Nuclear hormone receptor, agonist, NUCLEAR PROTEIN, nuclear protein-agonist complex
Deposited on 2018-07-13, released 2019-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6e3ga_
  • Chain 'B':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6e3gb_
  • Chain 'C':
    Compound: co-activator peptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6E3G (0-7)
  • Chain 'D':
    Compound: co-activator peptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6E3G (0-7)
  • Heterogens: EDO, HOJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3gA (A:)
    pyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercah
    hlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegky
    ggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveql
    qynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpply
    kelfs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3gB (B:)
    pyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercah
    hlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegky
    ggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveql
    qynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpply
    kelfs
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.