PDB entry 6e3e

View 6e3e on RCSB PDB site
Description: Structure of RORgt in complex with a novel inverse agonist.
Class: nuclear protein/agonist
Keywords: Nuclear hormone receptor, inverse agonist, nuclear protein-agonist complex
Deposited on 2018-07-13, released 2019-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e3ea_
  • Chain 'B':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e3eb_
  • Heterogens: SO4, MPD, HQ7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3eA (A:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqhve
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e3eB (B:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqhve