PDB entry 6e3a

View 6e3a on RCSB PDB site
Description: tRNA 2'-phosphotransferase
Class: transferase
Keywords: KptA, Tpt1, TRPT1, TRANSFERASE
Deposited on 2018-07-13, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable RNA 2'-phosphotransferase
    Species: Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) [TaxId:203119]
    Gene: kptA, Cthe_3059
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e3aa_
  • Heterogens: COA, HQG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e3aA (A:)
    mvlidysklskevayalrhapweygleldaegwvdinqllsslhecekwkkvsehdlhvm
    ieksdkkryeisngkiralyghsipqriikeqkcppevlyhgtarrfvksikekglqpqg
    rqyvhlsadvetalqvgkrrdikpvllivnaleawsegikfylgndkvwladaipskyir
    fe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e3aA (A:)
    lidysklskevayalrhapweygleldaegwvdinqllsslhecekwkkvsehdlhvmie
    ksdkkryeisngkiralyghsipqriikeqkcppevlyhgtarrfvksikekglqpqgrq
    yvhlsadvetalqvgkrrdikpvllivnaleawsegikfylgndkvwladaipskyirfe