PDB entry 6e35

View 6e35 on RCSB PDB site
Description: Crystal structure of human indoleamime 2,3-dioxygenase (IDO1) in complex with L-Trp and cyanide, Northeast Structural Genomics Target HR6160
Class: oxidoreductase
Keywords: 2, 3-dioxygenate, Structural Genomics, PSI-Biology, Northeast Structural Genomics Consortium, NESG, OXIDOREDUCTASE
Deposited on 2018-07-13, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Indoleamine 2,3-dioxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IDO1, IDO, INDO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e35a_
  • Chain 'B':
    Compound: Indoleamine 2,3-dioxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IDO1, IDO, INDO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e35b_
  • Heterogens: HEM, CYN, TRP, ZCW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e35A (A:)
    mskeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhl
    tdhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadcv
    lanwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamqm
    qerdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvye
    gfwedpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcsl
    esnpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqqpkenktsed
    pskleakgtggtdlmnflktvrstteksllkegkgelnsklegkpipnpllgldstrtgh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e35A (A:)
    npqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhltdhksqrlarlvlgci
    tmayvwgkghgdvrkvlprniavpycqlskklelppilvyadcvlanwkkkdpnkpltye
    nmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamqmqerdtllkalleiasc
    lekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvyegfwedpkefaggsagq
    ssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcslesnpsvrefvlskgda
    glreaydacvkalvslrsyhlqivtkyilipasqqpkleakgtggtdlmnflktvrstte
    ksllk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6e35B (B:)
    mskeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhl
    tdhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadcv
    lanwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamqm
    qerdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvye
    gfwedpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcsl
    esnpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqqpkenktsed
    pskleakgtggtdlmnflktvrstteksllkegkgelnsklegkpipnpllgldstrtgh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e35B (B:)
    pnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhltdhksqrlarlvlgc
    itmayvwgkghgdvrkvlprniavpycqlskklelppilvyadcvlanwkkkdpnkplty
    enmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamqmqerdtllkalleias
    clekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvyegfwedpkefaggsag
    qssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcslesnpsvrefvlskgd
    aglreaydacvkalvslrsyhlqivtkyilipasqqpleakgtggtdlmnflktvrstte
    ksllke