PDB entry 6e2m

View 6e2m on RCSB PDB site
Description: ASK1 kinase domain complex with inhibitor
Class: transferase/inhibitor
Keywords: protein kinase, inhibitor complex, TRANSFERASE-INHIBITOR complex
Deposited on 2018-07-11, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mitogen-activated protein kinase kinase kinase 5
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP3K5, ASK1, MAPKKK5, MEKK5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e2ma_
  • Chain 'B':
    Compound: mitogen-activated protein kinase kinase kinase 5
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP3K5, ASK1, MAPKKK5, MEKK5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e2mb_
  • Heterogens: KK7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e2mA (A:)
    gsrsteegdcesdlleydyeydengdrvvlgkgtygivyagrdlsnqvriaikeiperds
    rysqplheeialhkhlkhknivqylgsfsengfikifmeqvpggslsallrskwgplkdn
    eqtigfytkqileglkylhdnqivhrdikgdnvlintysgvlkisdfgtskrlaginpct
    etftgtlqymapeiidkgprgygkaadiwslgctiiematgkppfyelgepqaamfkvgm
    fkvhpeipesmsaeakafilkcfepdpdkracandllvdeflkvsskkkktqpkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e2mA (A:)
    lleydyeydengdrvvlgkgtygivyagrdlsnqvriaikeipysqplheeialhkhlkh
    knivqylgsfsenfikifmeqvpggslsallrskwgplkdneqtigfytkqileglkylh
    dnqivhrdikgdnvlintysgvlkisdfgtskrlapctetftgtlqymapeiidkgprgy
    gkaadiwslgctiiematgkppfyelgepqaamfkvgmfkvhpeipesmsaeakafilkc
    fepdpdkracandllvdeflk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6e2mB (B:)
    gsrsteegdcesdlleydyeydengdrvvlgkgtygivyagrdlsnqvriaikeiperds
    rysqplheeialhkhlkhknivqylgsfsengfikifmeqvpggslsallrskwgplkdn
    eqtigfytkqileglkylhdnqivhrdikgdnvlintysgvlkisdfgtskrlaginpct
    etftgtlqymapeiidkgprgygkaadiwslgctiiematgkppfyelgepqaamfkvgm
    fkvhpeipesmsaeakafilkcfepdpdkracandllvdeflkvsskkkktqpkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e2mB (B:)
    leydyeydengdrvvlgkgtygivyagrdlsnqvriaikeipqplheeialhkhlkhkni
    vqylgsfsengfikifmeqvpggslsallrskwgplkdneqtigfytkqileglkylhdn
    qivhrdikgdnvlintysgvlkisdfgtskrltgtlqymapeiidkgkaadiwslgctii
    ematgkppfyelgepqaamfkvgmfkvhpeipesmsaeakafilkcfepdpdkracandl
    lvdeflkv