PDB entry 6e20

View 6e20 on RCSB PDB site
Description: Crystal structure of the Dario rerio galectin-1-L2
Class: sugar binding protein
Keywords: Galectin-1, innate immunity infectious hematopoietic necrosis virus (IHNV), Danio rerio, zebrafish, SUGAR BINDING PROTEIN
Deposited on 2018-07-10, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin
    Species: Danio rerio [TaxId:7955]
    Gene: lgals2a, lgals1l2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e20a_
  • Chain 'B':
    Compound: galectin
    Species: Danio rerio [TaxId:7955]
    Gene: lgals2a, lgals1l2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e20b_
  • Heterogens: NDG, GAL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e20A (A:)
    magvliqnmsfkvgqtltitgvpkpdstnfainighspedialhmnprfdahgdqctivc
    nsfqsgswceehrddnfpfiqdkefqikitftneeflvtlpdgseihfpnrqgsekykym
    yfegevriqgveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e20A (A:)
    agvliqnmsfkvgqtltitgvpkpdstnfainighspedialhmnprfdahgdqctivcn
    sfqsgswceehrddnfpfiqdkefqikitftneeflvtlpdgseihfpnrqgsekykymy
    fegevriqgvei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6e20B (B:)
    magvliqnmsfkvgqtltitgvpkpdstnfainighspedialhmnprfdahgdqctivc
    nsfqsgswceehrddnfpfiqdkefqikitftneeflvtlpdgseihfpnrqgsekykym
    yfegevriqgveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e20B (B:)
    agvliqnmsfkvgqtltitgvpkpdstnfainighspedialhmnprfdahgdqctivcn
    sfqsgswceehrddnfpfiqdkefqikitftneeflvtlpdgseihfpnrqgsekykymy
    fegevriqgveik