PDB entry 6e1z

View 6e1z on RCSB PDB site
Description: Displacement of WDR5 from chromatin by a pharmacological WIN site inhibitor with picomolar affinity
Class: gene regulation/inhibitor
Keywords: WDR5, WIN-site, fragment screening, structure-based design, mixed-lineage leukemia, DNA BINDING PROTEIN, dna binding protein-inhibitor complex, GENE REGULATION, gene regulation-inhibitor complex
Deposited on 2018-07-10, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: WD repeat-containing protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: WDR5, BIG3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e1za_
  • Chain 'B':
    Compound: WD repeat-containing protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: WDR5, BIG3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e1zb_
  • Heterogens: HLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e1zA (A:)
    satqskptpvkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfek
    tisghklgisdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqs
    nlivsgsfdesvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdta
    sgqclktlidddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekyc
    ifanfsvtggkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaal
    endktiklwksdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e1zA (A:)
    ptpvkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghk
    lgisdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsg
    sfdesvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclk
    tlidddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfs
    vtggkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendkti
    klwksdc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6e1zB (B:)
    satqskptpvkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfek
    tisghklgisdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqs
    nlivsgsfdesvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdta
    sgqclktlidddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekyc
    ifanfsvtggkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaal
    endktiklwksdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e1zB (B:)
    pvkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklg
    isdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsf
    desvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktl
    idddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvt
    ggkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktikl
    wksdc