PDB entry 6e1x

View 6e1x on RCSB PDB site
Description: Crystal structure of product-bound complex of spermidine/spermine N-acetyltransferase SpeG
Class: transferase
Keywords: SpeG, polyamine, GNAT, N-acetyltransferase, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE
Deposited on 2018-07-10, released 2019-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spermidine N(1)-acetyltransferase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: speG, VC_A0947
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e1xa_
  • Chain 'B':
    Compound: Spermidine N(1)-acetyltransferase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: speG, VC_A0947
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e1xb_
  • Chain 'C':
    Compound: Spermidine N(1)-acetyltransferase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: speG, VC_A0947
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KL03 (3-175)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6e1xc1, d6e1xc2
  • Chain 'D':
    Compound: Spermidine N(1)-acetyltransferase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: speG, VC_A0947
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KL03 (3-175)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6e1xd1, d6e1xd2
  • Chain 'E':
    Compound: Spermidine N(1)-acetyltransferase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: speG, VC_A0947
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e1xe_
  • Chain 'F':
    Compound: Spermidine N(1)-acetyltransferase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: speG, VC_A0947
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e1xf_
  • Heterogens: SPM, SP5, MRD, TRS, MPD, HLG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e1xA (A:)
    snamnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerr
    fvvedaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlh
    kiylhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e1xA (A:)
    nsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvve
    daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl
    hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6e1xB (B:)
    snamnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerr
    fvvedaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlh
    kiylhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e1xB (B:)
    nsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvve
    daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl
    hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskyln
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e1xC (C:)
    snamnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerr
    fvvedaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlh
    kiylhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e1xD (D:)
    snamnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerr
    fvvedaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlh
    kiylhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6e1xE (E:)
    snamnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerr
    fvvedaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlh
    kiylhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e1xE (E:)
    qltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvveda
    qknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiylhv
    avenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6e1xF (F:)
    snamnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerr
    fvvedaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlh
    kiylhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e1xF (F:)
    qltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvveda
    qknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiylhv
    avenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnr