PDB entry 6e1a

View 6e1a on RCSB PDB site
Description: Menin bound to M-89
Class: protein binding
Keywords: inhibitor, protein binding, transcription
Deposited on 2018-07-09, released 2019-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Menin
    Species: Homo sapiens [TaxId:9606]
    Gene: MEN1, SCG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e1aa1, d6e1aa2
  • Heterogens: HL7, 7PR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e1aA (A:)
    sglkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrviptnvpe
    ltfqpspapdppggltyfpvadlsiiaalyarftaqirgavdlslypreggvssrelvkk
    vsdviwnslsrsyfkdrahiqslfsfitgtkldssgvafavvgacqalglrdvhlalsed
    hawvvfgpngeqtaevtwhgkgnedrrgqtvnagvaerswlylkgsymrcdrkmevafmv
    cainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleeleptpgrpdplt
    lyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqdynycredeei
    ykeffevandvipnllkeaaslleageerpgeqsqgtqsqgsalqdpecfahllrfydgi
    ckweegsptpvlhvgwatflvqslgrfegqvrqkvrivsgtvagtargpeggstaqvpap
    taspppegpvltfqsekmkgmkellvatkinssaiklqltaqsqvqmkkqkvstpsdytl
    sflkrqrkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e1aA (A:)
    glkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrviptnvpel
    tfqpspapdgltyfpvadlsiiaalyarftaqirgavdlslypreggvssrelvkkvsdv
    iwnslsrsyfkdrahiqslfsfitgtkldssgvafavvgacqalglrdvhlalsedhawv
    vfgpngeqtaevtwhgkgnedrrgqtvnagvaerswlylkgsymrcdrkmevafmvcain
    psidlhtdslellqlqqkllwllydlghlerypmalgnladleeleptpgrpdpltlyhk
    giasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqdynycredeeiykef
    fevandvipnllkeaaslleasalqdpecfahllrfydgickweegsptpvlhvgwatfl
    vqslgrfegqvrqkvrivsgtvagtargpvltfqsekmkgmkellvatkinssaiklqlt
    a