PDB entry 6e0u

View 6e0u on RCSB PDB site
Description: Staphylococcus pseudintermedius exfoliative toxin EXI
Class: hydrolase, toxin
Keywords: exfoliative toxin, exi, Staphylococcus pseudintermedius, HYDROLASE, TOXIN
Deposited on 2018-07-06, released 2019-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine protease
    Species: Staphylococcus pseudintermedius [TaxId:283734]
    Gene: exi
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e0ua_
  • Chain 'B':
    Compound: serine protease
    Species: Staphylococcus pseudintermedius [TaxId:283734]
    Gene: exi
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e0ub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e0uA (A:)
    yneeeilkkqeffkarpsdpelfmkvkdttkppynavgtvfvkgktlatgvligkntivt
    nyhiarqaeknpsniiftpgstredlivnapygtfeaeeinehpygqgldlaiiklkpnq
    dgksageliqpakipekidiqardkisllgypynfsthslfrsqielydviegqyfgyte
    pgnsgsgifnlngellgihvgkggrynlligeffnrsissfysidknvttlgedlkkrak
    lqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e0uA (A:)
    yneeeilkkqeffkarpsdpelfmkvkdttkppynavgtvfvkgktlatgvligkntivt
    nyhiarqaeknpsniiftpgstrlivnapygtfeaeeinehpygqgldlaiiklkpnqdg
    ksageliqpakipekidiqardkisllgypynfsthslfrsqielydviegqyfgytepg
    nsgsgifnlngellgihvgkggrynlligeffnrsissfysidknvttlgedlkkraklq
    e
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6e0uB (B:)
    yneeeilkkqeffkarpsdpelfmkvkdttkppynavgtvfvkgktlatgvligkntivt
    nyhiarqaeknpsniiftpgstredlivnapygtfeaeeinehpygqgldlaiiklkpnq
    dgksageliqpakipekidiqardkisllgypynfsthslfrsqielydviegqyfgyte
    pgnsgsgifnlngellgihvgkggrynlligeffnrsissfysidknvttlgedlkkrak
    lqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e0uB (B:)
    eeilkkqeffkarpsdpelfmkvkdttkppynavgtvfvkgktlatgvligkntivtnyh
    iarqaeknpsniiftpgstredlivnapygtfeaeeinehpygqgldlaiiklkpnqdgk
    sageliqpakipekidiqardkisllgypynfsthslfrsqielydviegqyfgytepgn
    sgsgifnlngellgihvgkggrynlligeffnrsissfysidknvttlgedlkkraklqe