PDB entry 6e0s

View 6e0s on RCSB PDB site
Description: Crystal structure of MEM-A1, a subclass B3 metallo-beta-lactamase isolated from a soil metagenome library
Class: hydrolase
Keywords: beta lactamase, metallo-beta-lactamase, antibiotic resistance, soil, metagenomics, structural genomics, NIAID, national institute of allergy and infectious diseases, CSGID, center for structural genomics of infectious diseases, HYDROLASE
Deposited on 2018-07-06, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mem-a1
    Species: soil metagenome [TaxId:410658]
    Database cross-references and differences (RAF-indexed):
    • PDB 6E0S (Start-285)
    Domains in SCOPe 2.07: d6e0sa_
  • Heterogens: ZN, PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e0sA (A:)
    mkrlmlsavlaagvpampamaedwndpqepfavfgstyyvgvrglsavliaspqghilid
    ggspesapqiaqhirqlgfkledvklilnshehfdhaggiselqrlsgatvlasvqgekv
    lrsgqpskgdpqygelppmtpvantravadgevvklgplavtarytpghtqggvswtwra
    tengksaamvyadslnafaakpfrysgspaypnaladikksiatvaaldcdilisahpda
    gdlwrrqarqaelgsaafidrqacrqyaeragvrlqkklaaeaaek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e0sA (A:)
    dwndpqepfavfgstyyvgvrglsavliaspqghilidggspesapqiaqhirqlgfkle
    dvklilnshehfdhaggiselqrlsgatvlasvqgekvlrsgqpskgdpqygelppmtpv
    antravadgevvklgplavtarytpghtqggvswtwratengksaamvyadslnafaakp
    frysgspaypnaladikksiatvaaldcdilisahpdagdlwrrqarqaelgsaafidrq
    acrqyaeragvrlqkklaaeaaek