PDB entry 6e0r

View 6e0r on RCSB PDB site
Description: hALK in complex with compound 7 N-((1S)-1-(5-fluoropyridin-2-yl)ethyl)-1-(5-methyl-1H-pyrazol-3-yl)-3-(oxetan-3-ylsulfonyl)-1H-pyrrolo[2,3-b]pyridin-6-amine
Class: protein binding
Keywords: Inhibitor, complex, kinase, sbdd, PROTEIN BINDING
Deposited on 2018-07-06, released 2019-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ALK tyrosine kinase receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ALK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e0ra_
  • Heterogens: HKJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e0rA (A:)
    gamgstdynpnycfagktssisdlkevprknitlirglghgafgevyegqvsgmpndpsp
    lqvavktlpevcseqdeldflmealiiskfnhqnivrcigvslqslprfillelmaggdl
    ksflretrprpsqpsslamldllhvardiacgcqyleenhfihrdiaarnclltcpgpgr
    vakigdfgmardiyrasyyrkggcamlpvkwmppeafmegiftsktdtwsfgvllweifs
    lgympypsksnqevlefvtsggrmdppkncpgpvyrimtqcwqhqpedrpnfaiilerie
    yctqdpdvintalpieygplve
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e0rA (A:)
    agktssisdlkevprknitlirglghgvyegqvsplqvavktlpevcseqdeldflmeal
    iiskfnhqnivrcigvslqslprfillelmaggdlksflretrprpsqpsslamldllhv
    ardiacgcqyleenhfihrdiaarnclltcpgpgrvakigdfgmardiymlpvkwmppea
    fmegiftsktdtwsfgvllweifslgympypsksnqevlefvtsggrmdppkncpgpvyr
    imtqcwqhqpedrpnfaiilerieyctqdpdvintalpi