PDB entry 6e0e

View 6e0e on RCSB PDB site
Description: Crystal structure of Glucokinase in complex with compound 6
Class: Transferase/Transferase Inhibitor
Keywords: Glucokinase, glucokinase activator, structure-aided design, structure-based design, type II diabetes, Transferase-Transferase Inhibitor complex
Deposited on 2018-07-06, released 2019-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucokinase
    Species: Homo sapiens [TaxId:9606]
    Gene: GCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e0ea1, d6e0ea2
  • Heterogens: HKM, GLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e0eA (A:)
    tlveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrstpegsevgd
    flsldlggtnfrvmlvkvgegeegqwsvktkhqmysipedamtgtaemlfdyisecisdf
    ldkhqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrdaikrrg
    dfemdvvamvndtvatmiscyyedhqcevgmivgtgcnacymeemqnvelvegdegrmcv
    ntewgafgdsgeldeflleydrlvdessanpgqqlyekliggkymgelvrlvllrlvden
    llfhgeaseqlrtrgafetrfvsqvesdtgdrkqiynilstlglrpsttdcdivrraces
    vstraahmcsaglagvinrmresrsedvmritvgvdgsvyklhpsfkerfhasvrrltps
    ceitfieseegsgrgaalvsavackkac