PDB entry 6e0d

View 6e0d on RCSB PDB site
Description: X-ray structure of a complex of thaumatin with xylene cyanol
Class: plant protein/antibiotic
Keywords: SWEET TASTING PROTEIN, disulfides, dye binding, xylene cyanol, PLANT PROTEIN, PLANT PROTEIN-ANTIBIOTIC complex
Deposited on 2018-07-06, released 2018-09-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thaumatin I
    Species: Thaumatococcus daniellii [TaxId:4621]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02883
      • conflict (67)
    Domains in SCOPe 2.08: d6e0da_
  • Heterogens: TLA, XXX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e0dA (A:)
    maattcffflfpflllltlsraatfeivnrcsytvwaaaskgdaaldaggrqlnsgeswt
    invepgtkggkiwartdcyfddsgsgicktgdcggllrckrfgrppttlaefslnqygkd
    yidisnikgfnvpmdfspttrgcrgvrcaadivgqcpaklkapgggcndactvfqtseyc
    cttgkcgpteysrffkrlcpdafsyvldkpttvtcpgssnyrvtfcptalelede
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e0dA (A:)
    atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtkggkiwartdcyfdd
    sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
    crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
    fsyvldkpttvtcpgssnyrvtfcpt