PDB entry 6dzx

View 6dzx on RCSB PDB site
Description: Crystal structure of the N. meningitides methionine-binding protein in its D-methionine bound conformation.
Class: protein binding
Keywords: methionine-binding protein, PROTEIN BINDING
Deposited on 2018-07-05, released 2019-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoprotein
    Species: Neisseria meningitidis alpha153 [TaxId:663926]
    Gene: sfbA, NME_0028
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6S9R8
      • conflict (23)
    Domains in SCOPe 2.07: d6dzxa_
  • Chain 'B':
    Compound: Lipoprotein
    Species: Neisseria meningitidis alpha153 [TaxId:663926]
    Gene: sfbA, NME_0028
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6S9R8 (2-End)
      • conflict (23)
    Domains in SCOPe 2.07: d6dzxb_
  • Chain 'C':
    Compound: Lipoprotein
    Species: Neisseria meningitidis alpha153 [TaxId:663926]
    Gene: sfbA, NME_0028
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6S9R8 (2-End)
      • conflict (23)
    Domains in SCOPe 2.07: d6dzxc_
  • Chain 'D':
    Compound: Lipoprotein
    Species: Neisseria meningitidis alpha153 [TaxId:663926]
    Gene: sfbA, NME_0028
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6S9R8 (2-End)
      • conflict (23)
    Domains in SCOPe 2.07: d6dzxd_
  • Chain 'E':
    Compound: Lipoprotein
    Species: Neisseria meningitidis alpha153 [TaxId:663926]
    Gene: sfbA, NME_0028
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6S9R8 (2-End)
      • conflict (23)
    Domains in SCOPe 2.07: d6dzxe_
  • Chain 'F':
    Compound: Lipoprotein
    Species: Neisseria meningitidis alpha153 [TaxId:663926]
    Gene: sfbA, NME_0028
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6S9R8
      • conflict (23)
    Domains in SCOPe 2.07: d6dzxf_
  • Heterogens: MED, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dzxA (A:)
    khkeivfgttvgdfgdmvkeqiqaelekkgytvklveftdyvrpnlalaegeldinvfqh
    kpylddfkkehnlditevfqvptaplglypgklksleevkdgstvsapndpsnfarvlvm
    ldelgwiklkdginpltaskadiaenlknikiveleaaqlprsradvdfavvngnyaiss
    gmkltealfqepsfayvnwsavktadkdsqwlkdvteaynsdafkayahkrfegykspaa
    wnegaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dzxA (A:)
    eivfgttvgdfgdmvkeqiqaelekkgytvklveftdyvrpnlalaegeldinvfqhkpy
    lddfkkehnlditevfqvptaplglypgklksleevkdgstvsapndpsnfarvlvmlde
    lgwiklkdginpltaskadiaenlknikiveleaaqlprsradvdfavvngnyaissgmk
    ltealfqepsfayvnwsavktadkdsqwlkdvteaynsdafkayahkrfegykspaawne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dzxB (B:)
    khkeivfgttvgdfgdmvkeqiqaelekkgytvklveftdyvrpnlalaegeldinvfqh
    kpylddfkkehnlditevfqvptaplglypgklksleevkdgstvsapndpsnfarvlvm
    ldelgwiklkdginpltaskadiaenlknikiveleaaqlprsradvdfavvngnyaiss
    gmkltealfqepsfayvnwsavktadkdsqwlkdvteaynsdafkayahkrfegykspaa
    wnegaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dzxB (B:)
    keivfgttvgdfgdmvkeqiqaelekkgytvklveftdyvrpnlalaegeldinvfqhkp
    ylddfkkehnlditevfqvptaplglypgklksleevkdgstvsapndpsnfarvlvmld
    elgwiklkdginpltaskadiaenlknikiveleaaqlprsradvdfavvngnyaissgm
    kltealfqepsfayvnwsavktadkdsqwlkdvteaynsdafkayahkrfegykspaawn
    e
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dzxC (C:)
    khkeivfgttvgdfgdmvkeqiqaelekkgytvklveftdyvrpnlalaegeldinvfqh
    kpylddfkkehnlditevfqvptaplglypgklksleevkdgstvsapndpsnfarvlvm
    ldelgwiklkdginpltaskadiaenlknikiveleaaqlprsradvdfavvngnyaiss
    gmkltealfqepsfayvnwsavktadkdsqwlkdvteaynsdafkayahkrfegykspaa
    wnegaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dzxC (C:)
    keivfgttvgdfgdmvkeqiqaelekkgytvklveftdyvrpnlalaegeldinvfqhkp
    ylddfkkehnlditevfqvptaplglypgklksleevkdgstvsapndpsnfarvlvmld
    elgwiklkdginpltaskadiaenlknikiveleaaqlprsradvdfavvngnyaissgm
    kltealfqepsfayvnwsavktadkdsqwlkdvteaynsdafkayahkrfegykspaawn
    e
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dzxD (D:)
    khkeivfgttvgdfgdmvkeqiqaelekkgytvklveftdyvrpnlalaegeldinvfqh
    kpylddfkkehnlditevfqvptaplglypgklksleevkdgstvsapndpsnfarvlvm
    ldelgwiklkdginpltaskadiaenlknikiveleaaqlprsradvdfavvngnyaiss
    gmkltealfqepsfayvnwsavktadkdsqwlkdvteaynsdafkayahkrfegykspaa
    wnegaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dzxD (D:)
    keivfgttvgdfgdmvkeqiqaelekkgytvklveftdyvrpnlalaegeldinvfqhkp
    ylddfkkehnlditevfqvptaplglypgklksleevkdgstvsapndpsnfarvlvmld
    elgwiklkdginpltaskadiaenlknikiveleaaqlprsradvdfavvngnyaissgm
    kltealfqepsfayvnwsavktadkdsqwlkdvteaynsdafkayahkrfegykspaawn
    e
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6dzxE (E:)
    khkeivfgttvgdfgdmvkeqiqaelekkgytvklveftdyvrpnlalaegeldinvfqh
    kpylddfkkehnlditevfqvptaplglypgklksleevkdgstvsapndpsnfarvlvm
    ldelgwiklkdginpltaskadiaenlknikiveleaaqlprsradvdfavvngnyaiss
    gmkltealfqepsfayvnwsavktadkdsqwlkdvteaynsdafkayahkrfegykspaa
    wnegaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dzxE (E:)
    keivfgttvgdfgdmvkeqiqaelekkgytvklveftdyvrpnlalaegeldinvfqhkp
    ylddfkkehnlditevfqvptaplglypgklksleevkdgstvsapndpsnfarvlvmld
    elgwiklkdginpltaskadiaenlknikiveleaaqlprsradvdfavvngnyaissgm
    kltealfqepsfayvnwsavktadkdsqwlkdvteaynsdafkayahkrfegykspaawn
    eg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6dzxF (F:)
    khkeivfgttvgdfgdmvkeqiqaelekkgytvklveftdyvrpnlalaegeldinvfqh
    kpylddfkkehnlditevfqvptaplglypgklksleevkdgstvsapndpsnfarvlvm
    ldelgwiklkdginpltaskadiaenlknikiveleaaqlprsradvdfavvngnyaiss
    gmkltealfqepsfayvnwsavktadkdsqwlkdvteaynsdafkayahkrfegykspaa
    wnegaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dzxF (F:)
    eivfgttvgdfgdmvkeqiqaelekkgytvklveftdyvrpnlalaegeldinvfqhkpy
    lddfkkehnlditevfqvptaplglypgklksleevkdgstvsapndpsnfarvlvmlde
    lgwiklkdginpltaskadiaenlknikiveleaaqlprsradvdfavvngnyaissgmk
    ltealfqepsfayvnwsavktadkdsqwlkdvteaynsdafkayahkrfegykspaawne