PDB entry 6dzr

View 6dzr on RCSB PDB site
Description: Crystal structure of h38C2 K99R mutation
Class: immune system
Keywords: Antibody, IMMUNE SYSTEM
Deposited on 2018-07-05, released 2019-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: h38c2 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DZR (0-219)
  • Chain 'L':
    Compound: h38c2 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DZR (0-217)
    Domains in SCOPe 2.07: d6dzrl1, d6dzrl2
  • Heterogens: FLC, SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dzrL (L:)
    elqmtqspsslsasvgdrvtitcrssqsllhtygspylnwylqkpgqspklliykvsnrf
    sgvpsrfsgsgsgtdftltisslqpedfavyfcsqgthlpytfgggtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrge