PDB entry 6dzh

View 6dzh on RCSB PDB site
Description: HRAS G13D bound to GDP (H13GDP)
Class: signaling protein
Keywords: Oncogene, RAS, p21, SIGNALING PROTEIN
Deposited on 2018-07-04, released 2019-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d6dzha_
  • Chain 'B':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d6dzhb_
  • Chain 'C':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d6dzhc_
  • Heterogens: GDP, MG, GOL, CA, DTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dzhA (A:)
    mteyklvvvgagdvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dzhA (A:)
    mteyklvvvgagdvgksaltiqliqnhfvdeydptedsyrkqvvidgetclldildtagq
    eeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdla
    artvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dzhB (B:)
    mteyklvvvgagdvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dzhB (B:)
    mteyklvvvgagdvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtam
    rtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartvesrqaqd
    larsygipyietsaktrqgvedafytlvreirqh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dzhC (C:)
    mteyklvvvgagdvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dzhC (C:)
    mteyklvvvgagdvgksaltiqliqnhfvsyrkqvvidgetclldildtagqeeydqymr
    tgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartvesrqaqdl
    arsygipyietsaktrqgvedafytlvreirqh