PDB entry 6dz5

View 6dz5 on RCSB PDB site
Description: Citrobacter freundii tyrosine phenol-lyase F448A mutant complexed with L-alanine
Class: lyase
Keywords: pyridoxal-5'-phosphate, aminotransferase fold, LYASE
Deposited on 2018-07-03, released 2018-10-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: XRAY
Resolution: 2.2600000000000002 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine phenol-lyase
    Species: Citrobacter freundii [TaxId:546]
    Gene: TPL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31013 (Start-455)
      • engineered mutation (204)
      • engineered mutation (447)
    Domains in SCOPe 2.08: d6dz5a_
  • Chain 'B':
    Compound: tyrosine phenol-lyase
    Species: Citrobacter freundii [TaxId:546]
    Gene: TPL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31013 (Start-455)
      • engineered mutation (204)
      • engineered mutation (447)
    Domains in SCOPe 2.08: d6dz5b_
  • Heterogens: K, P61, P33, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dz5A (A:)
    mnypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkq
    wagmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagn
    myftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicl
    avtvnlaggqpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaei
    vhemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdme
    amaiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqde
    fpaqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvv
    adgiiklyqhkedirglkfiyepkqlraftarfdyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dz5A (A:)
    nypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkqw
    agmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagnm
    yftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicla
    vtvnlaggqpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaeiv
    hemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdmea
    maiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqdef
    paqslaasiyvetgvrsmergiisagrnnvhhrpkletvrltiprrvytyahmdvvadgi
    iklyqhkedirglkfiyepkqlraftarfdyi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dz5B (B:)
    mnypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkq
    wagmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagn
    myftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicl
    avtvnlaggqpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaei
    vhemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdme
    amaiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqde
    fpaqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvv
    adgiiklyqhkedirglkfiyepkqlraftarfdyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dz5B (B:)
    nypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkqw
    agmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagnm
    yftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicla
    vtvnlaggqpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaeiv
    hemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdmea
    maiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqdef
    paqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvva
    dgiiklyqhkedirglkfiyepkqlraftarfdyi