PDB entry 6dz4

View 6dz4 on RCSB PDB site
Description: Crystal structure of Salmonella typhimurium Tryptophan Synthase with sodium ion at the metal coordination site and [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine (PLS) at the beta-site.
Class: lyase
Keywords: F9F, PLS, Sodium ion, lyase, lyase inhibitor, Salmonella typhimurium
Deposited on 2018-07-02, released 2019-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase alpha chain
    Species: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) [TaxId:99287]
    Gene: TRPA, STM1727
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dz4a_
  • Chain 'B':
    Compound: tryptophan synthase beta chain
    Species: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) [TaxId:99287]
    Gene: trpB, STM1726
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dz4b_
  • Heterogens: CL, DMS, NA, PLS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dz4A (A:)
    meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
    gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
    vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
    gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
    ieknlaspkqmlaelrsfvsamkaasra
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dz4A (A:)
    meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
    gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
    vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllslp
    lhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkiieknlaspkqml
    aelrsfvsamkaasr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dz4B (B:)
    mttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptalt
    kcqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasa
    lasallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgs
    yetahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigm
    fadfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysi
    sagldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalk
    mmreqpekeqllvvnlsgrgdkdiftvhdilkargei
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dz4B (B:)
    ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
    cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
    asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
    etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
    adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
    agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
    mreqpekeqllvvnlsgrgdkdiftvhdilkarge