PDB entry 6dz2

View 6dz2 on RCSB PDB site
Description: Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3R,4S)-1-((4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl)-4-(((3-(1-benzyl-1H-1,2,3-triazol-4-yl)propyl)thio)methyl)pyrrolidin-3-ol
Class: transferase/transferase inhibitor
Keywords: MTAP enzyme, cancer, phosphorylase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2018-07-02, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-methyl-5'-thioadenosine phosphorylase
    Species: Homo sapiens [TaxId:9606]
    Gene: MTAP, MSAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dz2a_
  • Chain 'B':
    Compound: S-methyl-5'-thioadenosine phosphorylase
    Species: Homo sapiens [TaxId:9606]
    Gene: MTAP, MSAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dz2b_
  • Chain 'C':
    Compound: S-methyl-5'-thioadenosine phosphorylase
    Species: Homo sapiens [TaxId:9606]
    Gene: MTAP, MSAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dz2c_
  • Heterogens: EDO, CL, ACY, OS5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dz2A (A:)
    mhhhhhhenlyfqsmasgttttavkigiiggtglddpeilegrtekyvdtpfgkpsdali
    lgkiknvdcvllarhgrqhtimpskvnyqaniwalkeegcthvivttacgslreeiqpgd
    iviidqfidrttmrpqsfydgshscargvchipmaepfcpktrevlietakklglrchsk
    gtmvtiegprfssraesfmfrtwgadvinmttvpevvlakeagicyasiamatdydcwke
    heeavsvdrvlktlkenankakslllttipqigstewsetlhnlknmaqfsvllprh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dz2A (A:)
    avkigiiggtglddpeilegrtekyvdtpfgkpsdalilgkiknvdcvllarhgtimpsk
    vnyqaniwalkeegcthvivttacgslreeiqpgdiviidqfidrttmrpqsfydgshsc
    argvchipmaepfcpktrevlietakklglrchskgtmvtiegprfssraesfmfrtwga
    dvinmttvpevvlakeagicyasiamatdydcwkeheeavsvdrvlktlkenankaksll
    lttipqigstewsetlhnlknmaqfsvllp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dz2B (B:)
    mhhhhhhenlyfqsmasgttttavkigiiggtglddpeilegrtekyvdtpfgkpsdali
    lgkiknvdcvllarhgrqhtimpskvnyqaniwalkeegcthvivttacgslreeiqpgd
    iviidqfidrttmrpqsfydgshscargvchipmaepfcpktrevlietakklglrchsk
    gtmvtiegprfssraesfmfrtwgadvinmttvpevvlakeagicyasiamatdydcwke
    heeavsvdrvlktlkenankakslllttipqigstewsetlhnlknmaqfsvllprh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dz2B (B:)
    avkigiiggtglddpeilegrtekyvdtpfgkpsdalilgkiknvdcvllarhtimpskv
    nyqaniwalkeegcthvivttacgslreeiqpgdiviidqfidrttmrpqsfydgshsca
    rgvchipmaepfcpktrevlietakklglrchskgtmvtiegprfssraesfmfrtwgad
    vinmttvpevvlakeagicyasiamatdydcwkeheeavsvdrvlktlkenankakslll
    ttipqigstewsetlhnlknmaqfsvllp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dz2C (C:)
    mhhhhhhenlyfqsmasgttttavkigiiggtglddpeilegrtekyvdtpfgkpsdali
    lgkiknvdcvllarhgrqhtimpskvnyqaniwalkeegcthvivttacgslreeiqpgd
    iviidqfidrttmrpqsfydgshscargvchipmaepfcpktrevlietakklglrchsk
    gtmvtiegprfssraesfmfrtwgadvinmttvpevvlakeagicyasiamatdydcwke
    heeavsvdrvlktlkenankakslllttipqigstewsetlhnlknmaqfsvllprh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dz2C (C:)
    avkigiiggtglddpeilegrtekyvdtpfgkpsdalilgkiknvdcvlltimpskvnyq
    aniwalkeegcthvivttacgslreeiqpgdiviidqfidrttmrpqsfydgshscargv
    chipmaepfcpktrevlietakklglrchskgtmvtiegprfssraesfmfrtwgadvin
    mttvpevvlakeagicyasiamatdydcwkeheeavsvdrvlktlkenankaksllltti
    pqigstewsetlhnlknmaqfsvllp