PDB entry 6dyx

View 6dyx on RCSB PDB site
Description: Structure of VHH R419 isolated from a pre-immune phage display library
Class: immune system
Keywords: Nanobody VHH single domain antibody, IMMUNE SYSTEM
Deposited on 2018-07-02, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: vhh r419
    Species: Vicugna pacos [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DYX (0-End)
    Domains in SCOPe 2.07: d6dyxd1, d6dyxd2
  • Heterogens: SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dyxD (D:)
    qvkleesggglvqaggslrlscaasgrtystyamgwfrqtpgkerelvaainwsggnthy
    adsvkgrftisrdnakstvylqmnslkpedtavyycaapkghtgdhywgpgtqvtvsshh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dyxD (D:)
    qvkleesggglvqaggslrlscaasgrtystyamgwfrqtpgkerelvaainwsggnthy
    adsvkgrftisrdnakstvylqmnslkpedtavyycaapkghtgdhywgpgtqvtvs