PDB entry 6dyt

View 6dyt on RCSB PDB site
Description: Citrobacter freundii tyrosine phenol-lyase F448A mutant complexed with L-alanine
Class: lyase
Keywords: pyridoxal-5'-phosphate, aminotransferase fold, LYASE
Deposited on 2018-07-02, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine phenol-lyase
    Species: Citrobacter freundii [TaxId:546]
    Gene: TPL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31013 (Start-455)
      • conflict (204)
      • engineered mutation (447)
    Domains in SCOPe 2.07: d6dyta_
  • Chain 'B':
    Compound: tyrosine phenol-lyase
    Species: Citrobacter freundii [TaxId:546]
    Gene: TPL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31013 (Start-455)
      • conflict (204)
      • engineered mutation (447)
    Domains in SCOPe 2.07: d6dytb_
  • Heterogens: K, F0G, PP3, P33, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dytA (A:)
    mnypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkq
    wagmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagn
    myftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicl
    avtvnlaggqpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaei
    vhemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdme
    amaiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqde
    fpaqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvv
    adgiiklyqhkedirglkfiyepkqlraftarfdyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dytA (A:)
    nypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkqw
    agmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagnm
    yftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicla
    vtvnlaggqpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaeiv
    hemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdmea
    maiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqdef
    paqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvva
    dgiiklyqhkedirglkfiyepkqlraftarfdyi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dytB (B:)
    mnypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkq
    wagmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagn
    myftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicl
    avtvnlaggqpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaei
    vhemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdme
    amaiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqde
    fpaqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvv
    adgiiklyqhkedirglkfiyepkqlraftarfdyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dytB (B:)
    nypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkqw
    agmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagnm
    yftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicla
    vtvnlaggqpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaeiv
    hemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdmea
    maiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqdef
    paqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvva
    dgiiklyqhkedirglkfiyepkqlraftarfdyi