PDB entry 6dyk

View 6dyk on RCSB PDB site
Description: Iron- and Nitric Oxide-bound structure of the engineered cyt b562 variant, CH3Y*
Class: metal binding protein
Keywords: Designed protein, 4-helix bundle, METAL BINDING PROTEIN
Deposited on 2018-07-01, released 2019-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (6)
      • engineered mutation (58)
      • engineered mutation (66)
      • engineered mutation (69-70)
      • engineered mutation (95-96)
      • engineered mutation (100-101)
      • engineered mutation (105)
    Domains in SCOPe 2.07: d6dyka_
  • Chain 'C':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (6)
      • engineered mutation (58)
      • engineered mutation (66)
      • engineered mutation (69-70)
      • engineered mutation (95-96)
      • engineered mutation (100-101)
      • engineered mutation (105)
    Domains in SCOPe 2.07: d6dykc_
  • Chain 'E':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (6)
      • engineered mutation (58)
      • engineered mutation (66)
      • engineered mutation (69-70)
      • engineered mutation (95-96)
      • engineered mutation (100-101)
      • engineered mutation (105)
    Domains in SCOPe 2.07: d6dyke_
  • Chain 'G':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (6)
      • engineered mutation (58)
      • engineered mutation (66)
      • engineered mutation (69-70)
      • engineered mutation (95-96)
      • engineered mutation (100-101)
      • engineered mutation (105)
    Domains in SCOPe 2.07: d6dykg_
  • Heterogens: NO, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dykA (A:)
    adlednwetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemwd
    frhgfdhlvyhiddalklanegkvkeaqaaaeqlkchrnaaiqkyl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dykC (C:)
    adlednwetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemwd
    frhgfdhlvyhiddalklanegkvkeaqaaaeqlkchrnaaiqkyl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dykE (E:)
    adlednwetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemwd
    frhgfdhlvyhiddalklanegkvkeaqaaaeqlkchrnaaiqkyl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dykG (G:)
    adlednwetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemwd
    frhgfdhlvyhiddalklanegkvkeaqaaaeqlkchrnaaiqkyl