PDB entry 6dyi

View 6dyi on RCSB PDB site
Description: Co(II)-bound structure of the engineered cyt cb562 variant, H3
Class: metal binding protein
Keywords: Designed protein, 4-helix bundle, electron transport, METAL BINDING PROTEIN
Deposited on 2018-07-01, released 2019-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (58)
      • engineered mutation (66)
      • engineered mutation (70)
      • engineered mutation (96-97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d6dyib_
  • Heterogens: CO, HEC, CL, CA, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dyiB (B:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemwd
    frhgfdhlvghiddalklanegkvkeaqaaaeqlkthcnachqkyr