PDB entry 6dyd

View 6dyd on RCSB PDB site
Description: Cu(II)-bound structure of the engineered cyt cb562 variant, CH3
Class: metal binding protein
Keywords: Designed protein, 4-helix bundle, electron transport, METAL BINDING PROTEIN
Deposited on 2018-07-01, released 2019-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.7200000000000002 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (58)
      • engineered mutation (66)
      • engineered mutation (70)
      • engineered mutation (95-97)
      • engineered mutation (100)
    Domains in SCOPe 2.08: d6dyda_
  • Chain 'C':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (58)
      • engineered mutation (66)
      • engineered mutation (70)
      • engineered mutation (95-97)
      • engineered mutation (100)
    Domains in SCOPe 2.08: d6dydc_
  • Heterogens: CU, CA, HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dydA (A:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemwd
    frhgfdhlvghiddalklanegkvkeaqaaaeqlkchcnachqkyr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dydC (C:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemwd
    frhgfdhlvghiddalklanegkvkeaqaaaeqlkchcnachqkyr