PDB entry 6dya

View 6dya on RCSB PDB site
Description: WDR5 in complex with a WIN site inhibitor
Class: TRANSFERASE/TRANSFERASE inhibitor
Keywords: WD40 repeat, epigenetics, MLL binding, WIN site inhibitor, TRANSFERASE-TRANSFERASE inhibitor complex
Deposited on 2018-07-01, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: WD repeat-containing protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: WDR5, BIG3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dyaa_
  • Heterogens: HHM, SO4, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dyaA (A:)
    pvkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklg
    isdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsf
    desvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktl
    idddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvt
    ggkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktikl
    wksdc