PDB entry 6dy6

View 6dy6 on RCSB PDB site
Description: Mn(II)-bound structure of the engineered cyt cb562 variant, CH2E
Class: metal binding protein
Keywords: Designed protein, 4-helix bundle, electron transport, METAL BINDING PROTEIN
Deposited on 2018-07-01, released 2019-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (58)
      • engineered mutation (66)
      • engineered mutation (70)
      • engineered mutation (95-97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d6dy6a_
  • Chain 'B':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (58)
      • engineered mutation (66)
      • engineered mutation (70)
      • engineered mutation (95-97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d6dy6b_
  • Heterogens: MN, HEC, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dy6A (A:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemwd
    frhgfdhlvghiddalklanegkvkeaqaaaeqlkcecnachqkyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dy6B (B:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemwd
    frhgfdhlvghiddalklanegkvkeaqaaaeqlkcecnachqkyr