PDB entry 6dxp

View 6dxp on RCSB PDB site
Description: The crystal structure of an FMN-dependent NADH-azoreductase from Klebsiella pneumoniae
Class: oxidoreductase
Keywords: azoreductase, OXIDOREDUCTASE
Deposited on 2018-06-29, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FMN-dependent NADH-azoreductase
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: azoR, B1727_12130, C3F39_21155
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1W1JPX6 (22-222)
      • expression tag (17-21)
    Domains in SCOPe 2.07: d6dxpa1, d6dxpa2
  • Chain 'B':
    Compound: FMN-dependent NADH-azoreductase
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: azoR, B1727_12130, C3F39_21155
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1W1JPX6 (22-222)
      • expression tag (19-21)
    Domains in SCOPe 2.07: d6dxpb1, d6dxpb2
  • Chain 'C':
    Compound: FMN-dependent NADH-azoreductase
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: azoR, B1727_12130, C3F39_21155
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dxpc_
  • Chain 'D':
    Compound: FMN-dependent NADH-azoreductase
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: azoR, B1727_12130, C3F39_21155
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1W1JPX6 (22-222)
      • expression tag (18-21)
    Domains in SCOPe 2.07: d6dxpd1, d6dxpd2
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dxpA (A:)
    mhhhhhhssgvdlgtenlyfqsmanvlvlkssingetsltnqlineflaarqaaghgdrl
    iehdlsamalptldrplfaalrgavdpqpaireavalsdqliaelkasdllvigapmynl
    nvptdlkkwfdlvararetfryteswpqglvegvravvvssrggihqgettdavtpylra
    vlglmgiqevefiyaegldnrphgrdagiasaraqiarlavpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxpA (A:)
    lyfqsmanvlvlkssingetsltnqlineflaarqaaghgdrliehdlsamalptldrpl
    faalrgavdpqpaireavalsdqliaelkasdllvigapmynlnvptdlkkwfdlvarar
    etfryteswpqglvegvravvvssrggihqgettdavtpylravlglmgiqevefiyaeg
    ldnrphgrdagiasaraqiarlavpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dxpB (B:)
    mhhhhhhssgvdlgtenlyfqsmanvlvlkssingetsltnqlineflaarqaaghgdrl
    iehdlsamalptldrplfaalrgavdpqpaireavalsdqliaelkasdllvigapmynl
    nvptdlkkwfdlvararetfryteswpqglvegvravvvssrggihqgettdavtpylra
    vlglmgiqevefiyaegldnrphgrdagiasaraqiarlavpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxpB (B:)
    fqsmanvlvlkssingetsltnqlineflaarqaaghgdrliehdlsamalptldrplfa
    alrgavdpqpaireavalsdqliaelkasdllvigapmynlnvptdlkkwfdlvararet
    fryteswpqglvegvravvvssrggihqgettdavtpylravlglmgiqevefiyaegld
    nrphgrdagiasaraqiarlavpa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dxpC (C:)
    mhhhhhhssgvdlgtenlyfqsmanvlvlkssingetsltnqlineflaarqaaghgdrl
    iehdlsamalptldrplfaalrgavdpqpaireavalsdqliaelkasdllvigapmynl
    nvptdlkkwfdlvararetfryteswpqglvegvravvvssrggihqgettdavtpylra
    vlglmgiqevefiyaegldnrphgrdagiasaraqiarlavpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxpC (C:)
    anvlvlkssingetsltnqlineflaarqaaghgdrliehdlsamalptldrplfaalrg
    avdpqpaireavalsdqliaelkasdllvigapmynlnvptdlkkwfdlvararetfryt
    eswpqglvegvravvvssrggihqgettdavtpylravlglmgiqevefiyaegldnrph
    grdagiasaraqiarlavpa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dxpD (D:)
    mhhhhhhssgvdlgtenlyfqsmanvlvlkssingetsltnqlineflaarqaaghgdrl
    iehdlsamalptldrplfaalrgavdpqpaireavalsdqliaelkasdllvigapmynl
    nvptdlkkwfdlvararetfryteswpqglvegvravvvssrggihqgettdavtpylra
    vlglmgiqevefiyaegldnrphgrdagiasaraqiarlavpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxpD (D:)
    yfqsmanvlvlkssingetsltnqlineflaarqaaghgdrliehdlsamalptldrplf
    aalrgavdpqpaireavalsdqliaelkasdllvigapmynlnvptdlkkwfdlvarare
    tfryteswpqglvegvravvvssrggihqgettdavtpylravlglmgiqevefiyaegl
    dnrphgrdagiasaraqiarlavpa