PDB entry 6dxn

View 6dxn on RCSB PDB site
Description: 1.95 Angstrom Resolution Crystal Structure of DsbA Disulfide Interchange Protein from Klebsiella pneumoniae.
Class: oxidoreductase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, DsbA oxidoreductase, Oxidoreductases., OXIDOREDUCTASE
Deposited on 2018-06-29, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thiol:disulfide interchange protein
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: BB785_17655, BKY56_010280, C3F39_04655
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dxna1, d6dxna2
  • Chain 'B':
    Compound: thiol:disulfide interchange protein
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: BB785_17655, BKY56_010280, C3F39_04655
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dxnb1, d6dxnb2
  • Chain 'C':
    Compound: thiol:disulfide interchange protein
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: BB785_17655, BKY56_010280, C3F39_04655
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dxnc1, d6dxnc2
  • Chain 'D':
    Compound: thiol:disulfide interchange protein
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: BB785_17655, BKY56_010280, C3F39_04655
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dxnd1, d6dxnd2
  • Heterogens: PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dxnA (A:)
    snakdyqagknftvihstvkqppplveffsfycgpcyafaerinvdtairkrlpddmkle
    kyhvsqmgplgpalteawavaqyagvdgkvekllfeglqvkrdiktaadivkvfnqlgit
    sekyaemqsnfmvkaliarqdnlvekmkvhgtpsfyvsgkyhinnaslaqddydtyaedm
    anlvlfllnkpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxnA (A:)
    nakdyqagknftvihstvkqppplveffsfycgpcyafaerinvdtairkrlpddmklek
    yhvsqmgplgpalteawavaqyagvdgkvekllfeglqvkrdiktaadivkvfnqlgits
    ekyaemqsnfmvkaliarqdnlvekmkvhgtpsfyvsgkyhinnaslaqddydtyaedma
    nlvlfllnkpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dxnB (B:)
    snakdyqagknftvihstvkqppplveffsfycgpcyafaerinvdtairkrlpddmkle
    kyhvsqmgplgpalteawavaqyagvdgkvekllfeglqvkrdiktaadivkvfnqlgit
    sekyaemqsnfmvkaliarqdnlvekmkvhgtpsfyvsgkyhinnaslaqddydtyaedm
    anlvlfllnkpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxnB (B:)
    nakdyqagknftvihstvkqppplveffsfycgpcyafaerinvdtairkrlpddmklek
    yhvsqmgplgpalteawavaqyagvdgkvekllfeglqvkrdiktaadivkvfnqlgits
    ekyaemqsnfmvkaliarqdnlvekmkvhgtpsfyvsgkyhinnaslaqddydtyaedma
    nlvlfllnkpl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dxnC (C:)
    snakdyqagknftvihstvkqppplveffsfycgpcyafaerinvdtairkrlpddmkle
    kyhvsqmgplgpalteawavaqyagvdgkvekllfeglqvkrdiktaadivkvfnqlgit
    sekyaemqsnfmvkaliarqdnlvekmkvhgtpsfyvsgkyhinnaslaqddydtyaedm
    anlvlfllnkpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxnC (C:)
    akdyqagknftvihstvkqppplveffsfycgpcyafaerinvdtairkrlpddmkleky
    hvsqmgplgpalteawavaqyagvdgkvekllfeglqvkrdiktaadivkvfnqlgitse
    kyaemqsnfmvkaliarqdnlvekmkvhgtpsfyvsgkyhinnaslaqddydtyaedman
    lvlfllnk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dxnD (D:)
    snakdyqagknftvihstvkqppplveffsfycgpcyafaerinvdtairkrlpddmkle
    kyhvsqmgplgpalteawavaqyagvdgkvekllfeglqvkrdiktaadivkvfnqlgit
    sekyaemqsnfmvkaliarqdnlvekmkvhgtpsfyvsgkyhinnaslaqddydtyaedm
    anlvlfllnkpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxnD (D:)
    nakdyqagknftvihstvkqppplveffsfycgpcyafaerinvdtairkrlpddmklek
    yhvsqmgplgpalteawavaqyagvdgkvekllfeglqvkrdiktaadivkvfnqlgits
    ekyaemqsnfmvkaliarqdnlvekmkvhgtpsfyvsgkyhinnaslaqddydtyaedma
    nlvlfllnkpl