PDB entry 6dxl

View 6dxl on RCSB PDB site
Description: Linked amidobenzimidazole STING agonist
Class: immune system/agonist
Keywords: agonist, DNA-sensor, cGAS, TBK1, IMMUNE SYSTEM, immune system-agonist complex
Deposited on 2018-06-29, released 2018-11-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-02, with a file datestamp of 2018-12-28.
Experiment type: XRAY
Resolution: 2.4499999999999997 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stimulator of interferon protein
    Species: Homo sapiens [TaxId:9606]
    Gene: STING, LOC340061, hCG_1782396
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6dxla_
  • Chain 'B':
    Compound: Stimulator of interferon protein
    Species: Homo sapiens [TaxId:9606]
    Gene: STING, LOC340061, hCG_1782396
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6dxlb_
  • Heterogens: HG4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dxlA (A:)
    fnvahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnl
    smadpnirfldklpqqtgdragikdrvysnsiyellengqragtcvleyatplqtlfams
    qysqagfsredrleqaklfcrtlediladapesqnncrliayqepaddssfslsqevlrh
    lrqeekeevtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxlA (A:)
    fnvahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnl
    smadpnirfldklpqqysnsiyellengqragtcvleyatplqtlfamsqysqagfsred
    rleqaklfcrtlediladapesqnncrliayqepadfslsqevlrhlrqeekeevtv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dxlB (B:)
    fnvahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnl
    smadpnirfldklpqqtgdragikdrvysnsiyellengqragtcvleyatplqtlfams
    qysqagfsredrleqaklfcrtlediladapesqnncrliayqepaddssfslsqevlrh
    lrqeekeevtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxlB (B:)
    fnvahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnl
    smadpnirfldklpqqtvysnsiyellengqragtcvleyatplqtlfamsqysqagfsr
    edrleqaklfcrtlediladapesqnncrliayqepssfslsqevlrhlrqeekeevtv