PDB entry 6dxh

View 6dxh on RCSB PDB site
Description: Structure of USP5 zinc-finger ubiquitin binding domain co-crystallized with 4-(4-tert-butylphenyl)-4-oxobutanoate
Class: hydrolase
Keywords: deubiquitinase, usp5, ubiquitin, structural genomics consortium, sgc, hydrolase
Deposited on 2018-06-28, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 5
    Species: Homo sapiens [TaxId:9606]
    Gene: USP5, ISOT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dxha_
  • Heterogens: HH4, UNX, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dxhA (A:)
    ggevrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsgg
    nnhavehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidmlkmqkt
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxhA (A:)
    vrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsggnnh
    avehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidmlkmqkt