PDB entry 6dxg

View 6dxg on RCSB PDB site
Description: amidobenzimidazole (ABZI) STING agonists
Class: immune system/agonist
Keywords: agonist, STING (stimulator of Interferon genes), transmembrane protein 173 (TMEM173), IMMUNE SYSTEM, immune system-inhibitor complex, immune system-agonist complex
Deposited on 2018-06-28, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stimulator of interferon protein
    Species: Homo sapiens [TaxId:9606]
    Gene: STING, LOC340061, hCG_1782396
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dxga_
  • Heterogens: HGJ, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dxgA (A:)
    fnvahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnl
    smadpnirfldklpqqtgdragikdrvysnsiyellengqragtcvleyatplqtlfams
    qysqagfsredrleqaklfcrtlediladapesqnncrliayqepaddssfslsqevlrh
    lrqeekeevtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxgA (A:)
    fnvahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnl
    smadpnirfldklpqqvysnsiyellengqragtcvleyatplqtlfamsqysqagfsre
    drleqaklfcrtlediladapesqnncrliayqepafslsqevlrhlrqeekeevtv