PDB entry 6dx9

View 6dx9 on RCSB PDB site
Description: Crystal structure of chalcone synthase from Equisetum arvense
Class: transferase
Keywords: Thiolase, Flavonoid, Polyketide synthase, TRANSFERASE
Deposited on 2018-06-28, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chalcone synthase
    Species: Equisetum arvense [TaxId:3258]
    Gene: CHS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dx9a1, d6dx9a2
  • Chain 'B':
    Compound: chalcone synthase
    Species: Equisetum arvense [TaxId:3258]
    Gene: CHS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dx9b1, d6dx9b2
  • Heterogens: CSD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dx9A (A:)
    mtvleesadassrrlaqrangpatvlaigtanpanvfeqssypdfyfditnsqhmtelkl
    kfsrmcqksgikkrymhlnseilkanpslcayweksldvrqdiavvevpklgkeaslkai
    kewgqpkskithlvfcttsgvdmpgadwaltkllglrpsvkrlmmyqqgcfaggtvlrva
    kdvaennkgarvlvvcseitcvtfrgpsethldslvgqalfgdgaaavilgsdplpeenp
    cfelhwsgsnilpdsdgaidghlrevgltfhlmkdvpgiisknigkvlndafrsafdesg
    naedrpasvndifwiahpggpaildqveekmklapekmratrdvlseygnmssacvlfim
    dhmrrmsaqnklqttgegldwgvllgfgpgltvetvllksirlac
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dx9A (A:)
    rlaqrangpatvlaigtanpanvfeqssypdfyfditnsqhmtelklkfsrmcqksgikk
    rymhlnseilkanpslcayweksldvrqdiavvevpklgkeaslkaikewgqpkskithl
    vfcttsgvdmpgadwaltkllglrpsvkrlmmyqqgcfaggtvlrvakdvaennkgarvl
    vvcseitcvtfrgpsethldslvgqalfgdgaaavilgsdplpeenpcfelhwsgsnilp
    dsdgaidghlrevgltfhlmkdvpgiisknigkvlndafrsafdesgnaedrpasvndif
    wiahpggpaildqveekmklapekmratrdvlseygnmssacvlfimdhmrrmsaqnklq
    ttgegldwgvllgfgpgltvetvllksirlac
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dx9B (B:)
    mtvleesadassrrlaqrangpatvlaigtanpanvfeqssypdfyfditnsqhmtelkl
    kfsrmcqksgikkrymhlnseilkanpslcayweksldvrqdiavvevpklgkeaslkai
    kewgqpkskithlvfcttsgvdmpgadwaltkllglrpsvkrlmmyqqgcfaggtvlrva
    kdvaennkgarvlvvcseitcvtfrgpsethldslvgqalfgdgaaavilgsdplpeenp
    cfelhwsgsnilpdsdgaidghlrevgltfhlmkdvpgiisknigkvlndafrsafdesg
    naedrpasvndifwiahpggpaildqveekmklapekmratrdvlseygnmssacvlfim
    dhmrrmsaqnklqttgegldwgvllgfgpgltvetvllksirlac
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dx9B (B:)
    rlaqrangpatvlaigtanpanvfeqssypdfyfditnsqhmtelklkfsrmcqksgikk
    rymhlnseilkanpslcayweksldvrqdiavvevpklgkeaslkaikewgqpkskithl
    vfcttsgvdmpgadwaltkllglrpsvkrlmmyqqgcfaggtvlrvakdvaennkgarvl
    vvcseitcvtfrgpsethldslvgqalfgdgaaavilgsdplpeenpcfelhwsgsnilp
    dsdgaidghlrevgltfhlmkdvpgiisknigkvlndafrsafdesgnaedrpasvndif
    wiahpggpaildqveekmklapekmratrdvlseygnmssacvlfimdhmrrmsaqnklq
    ttgegldwgvllgfgpgltvetvllksirla