PDB entry 6dws

View 6dws on RCSB PDB site
Description: Crystal structure of human GRP78 in complex with (2R,3R,4S,5R)-2-(6-amino-8-((2-chlorobenzyl)amino)-9H-purin-9-yl)-5-(hydroxymethyl)tetrahydrofuran-3,4-diol
Class: chaperone, transferase
Keywords: human GRP78, adenosine analog, chaperone, transferase
Deposited on 2018-06-27, released 2019-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmic reticulum chaperone BiP
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPA5, GRP78
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dwsa1, d6dwsa2
  • Chain 'B':
    Compound: Endoplasmic reticulum chaperone BiP
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPA5, GRP78
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dwsb1, d6dwsb2
  • Heterogens: HFY, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dwsA (A:)
    dvgtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqlt
    snpentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeei
    samvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaa
    aiaygldkregeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmeh
    fiklykkktgkdvrkdnravqklrrevekakralssqhqarieiesfyegedfsetltra
    kfeelnmdlfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkeps
    rginpdeavaygaavqagvlsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dwsB (B:)
    dvgtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqlt
    snpentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeei
    samvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaa
    aiaygldkregeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmeh
    fiklykkktgkdvrkdnravqklrrevekakralssqhqarieiesfyegedfsetltra
    kfeelnmdlfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkeps
    rginpdeavaygaavqagvlsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dwsB (B:)
    vgtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqlts
    npentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeeis
    amvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaaa
    iaygldkregeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmehf
    iklykkktgkdvrkdnravqklrrevekakralssqhqarieiesfyegedfsetltrak
    feelnmdlfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsr
    ginpdeavaygaavqagvlsg