PDB entry 6dwr

View 6dwr on RCSB PDB site
Description: Trypsin serine protease modified with the protease inhibitor cyanobenzylsulfonylfluoride
Class: hydrolase
Keywords: serine protease, HYDROLASE
Deposited on 2018-06-27, released 2019-07-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6dwra_
  • Heterogens: P5U, EDO, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dwrA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdxggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn