PDB entry 6dwq

View 6dwq on RCSB PDB site
Description: Subtilisin serine protease modified with the protease inhibitor cyanobenzylsulfonylfluoride
Class: hydrolase
Keywords: serine protease, subtilisin, HYDROLASE
Deposited on 2018-06-27, released 2019-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: XRAY
Resolution: 1.27 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KerA
    Species: Bacillus licheniformis [TaxId:1402]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FDF2 (0-273)
      • conflict (156)
      • conflict (159)
    Domains in SCOPe 2.07: d6dwqa_
  • Heterogens: P5U, EDO, NO3, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dwqA (A:)
    aqtvpygiplikadkvqaqgfkganvkvavldtgiqashpdlnvvggasfvageayntdg
    nghgthvagtvaaldnttgvlgvapsvslyavkvlnssgsgsysgivsgiewattngmdv
    inmslggasgstamkqavdnayargvvvvaaagnsgnsgstntigypakydsviavgavd
    snsnrasfssvgaelevmapgagvystyptntyatlngtxmasphvagaaalilskhpnl
    sasqvrnrlsstatylgssfyygkglinveaaaq