PDB entry 6dwh

View 6dwh on RCSB PDB site
Description: Crystal structure of complex of BBKI and Bovine Trypsin
Class: hydrolase
Keywords: hydrolase
Deposited on 2018-06-26, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dwha_
  • Chain 'B':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dwhb_
  • Chain 'C':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dwhc_
  • Chain 'D':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dwhd_
  • Chain 'E':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dwhe_
  • Chain 'F':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dwhf_
  • Chain 'G':
    Compound: Kunitz-type inihibitor
    Species: Bauhinia bauhinioides [TaxId:166014]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Kunitz-type inihibitor
    Species: Bauhinia bauhinioides [TaxId:166014]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Kunitz-type inihibitor
    Species: Bauhinia bauhinioides [TaxId:166014]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Kunitz-type inihibitor
    Species: Bauhinia bauhinioides [TaxId:166014]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Kunitz-type inihibitor
    Species: Bauhinia bauhinioides [TaxId:166014]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Kunitz-type inihibitor
    Species: Bauhinia bauhinioides [TaxId:166014]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dwhA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dwhB (B:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dwhC (C:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dwhD (D:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dwhE (E:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dwhF (F:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.