PDB entry 6dwg

View 6dwg on RCSB PDB site
Description: Crystal structure of Leishmania major dihydroorotate dehydrogenase mutant Q139A
Class: oxidoreductase
Keywords: dihydroorotate dehydrogenase, Leishmania major, mutant Q139A, OXIDOREDUCTASE
Deposited on 2018-06-26, released 2019-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydroorotate dehydrogenase (fumarate)
    Species: Leishmania major [TaxId:5664]
    Gene: DHODH, LMJF_16_0530
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4QEW7 (34-End)
      • expression tag (33)
      • engineered mutation (172)
    Domains in SCOPe 2.07: d6dwga1, d6dwga2
  • Chain 'B':
    Compound: Dihydroorotate dehydrogenase (fumarate)
    Species: Leishmania major [TaxId:5664]
    Gene: DHODH, LMJF_16_0530
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4QEW7 (34-End)
      • expression tag (32-33)
      • engineered mutation (172)
    Domains in SCOPe 2.07: d6dwgb1, d6dwgb2
  • Heterogens: FMN, SO4, GOL, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dwgA (A:)
    mgsshhhhhhssglvpagshmasmtggqqmgrgsmslqvnllnntfanpfmnaagvmctt
    teelvamtesasgslvsksctpalregnptpryqalplgsinsmglpnngfdfylayaae
    qhdygkkplflsmsglsmrenvemckrlaavatekgvilelnlscpnvpgkpavaydfda
    mrqcltavsevyphsfgvkmppyfdfahfdaaaeilnefpkvqfitcinsignglvidae
    tesvvikpkqgfgglggryvlptalaninafyrrcpgklifgcggvytgedaflhvlaga
    smvqvgtalqeegpsiferltsellgvmakkryqtldefrgkvrtldgtaestr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dwgA (A:)
    smslqvnllnntfanpfmnaagvmcttteelvamtesasgslvsksctpalregnptpry
    qalplgsinsmglpnngfdfylayaaeqhdygkkplflsmsglsmrenvemckrlaavat
    ekgvilelnlspavaydfdamrqcltavsevyphsfgvkmppyfdfahfdaaaeilnefp
    kvqfitcinsignglvidaetesvvikpkqgfgglggryvlptalaninafyrrcpgkli
    fgcggvytgedaflhvlagasmvqvgtalqeegpsiferltsellgvmakkryqtldefr
    gkvrtl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dwgB (B:)
    mgsshhhhhhssglvpagshmasmtggqqmgrgsmslqvnllnntfanpfmnaagvmctt
    teelvamtesasgslvsksctpalregnptpryqalplgsinsmglpnngfdfylayaae
    qhdygkkplflsmsglsmrenvemckrlaavatekgvilelnlscpnvpgkpavaydfda
    mrqcltavsevyphsfgvkmppyfdfahfdaaaeilnefpkvqfitcinsignglvidae
    tesvvikpkqgfgglggryvlptalaninafyrrcpgklifgcggvytgedaflhvlaga
    smvqvgtalqeegpsiferltsellgvmakkryqtldefrgkvrtldgtaestr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dwgB (B:)
    gsmslqvnllnntfanpfmnaagvmcttteelvamtesasgslvsksctpalregnptpr
    yqalplgsinsmglpnngfdfylayaaeqhdygkkplflsmsglsmrenvemckrlaava
    tekgvilelnlspavaydfdamrqcltavsevyphsfgvkmppyfdfahfdaaaeilnef
    pkvqfitcinsignglvidaetesvvikpkqgfgglggryvlptalaninafyrrcpgkl
    ifgcggvytgedaflhvlagasmvqvgtalqeegpsiferltsellgvmakkryqtldef
    rgkvrtl