PDB entry 6dwe

View 6dwe on RCSB PDB site
Description: Crystal structure of tryptophan synthase from M. tuberculosis - aminoacrylate- and BRD0059-bound form
Class: lyase/lyase inhibitor
Keywords: PLP, heterotetramer, amino acid biosynthesis, substrate channeling, allostery, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, LYASE-LYASE INHIBITOR complex
Deposited on 2018-06-26, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase alpha chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpA, Rv1613, MTCY01B2.05
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dwea_
  • Chain 'B':
    Compound: tryptophan synthase beta chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpB, Rv1612, MTCY01B2.04
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: tryptophan synthase alpha chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpA, Rv1613, MTCY01B2.05
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dwec_
  • Chain 'D':
    Compound: tryptophan synthase beta chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpB, Rv1612, MTCY01B2.04
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: tryptophan synthase alpha chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpA, Rv1613, MTCY01B2.05
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dwee_
  • Chain 'F':
    Compound: tryptophan synthase beta chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpB, Rv1612, MTCY01B2.04
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: tryptophan synthase alpha chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpA, Rv1613, MTCY01B2.05
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dweg_
  • Chain 'H':
    Compound: tryptophan synthase beta chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpB, Rv1612, MTCY01B2.04
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MLI, FMT, P1T, CS, HDJ, ACT, MLA, EDO, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dweA (A:)
    mvaveqseasrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgv
    pysdpgmdgptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdaf
    ardlaaagglglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfv
    yaastmgvtgardavsqaapelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgs
    alvtalteglprlraltgelaagvrlgmsahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dweA (A:)
    easrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgvpysdpgm
    dgptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdafardlaaa
    gglglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfvyaassqa
    apelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgsalvtalteglprlraltg
    elaagvrlg
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dweC (C:)
    mvaveqseasrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgv
    pysdpgmdgptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdaf
    ardlaaagglglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfv
    yaastmgvtgardavsqaapelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgs
    alvtalteglprlraltgelaagvrlgmsahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dweC (C:)
    easrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgvpysdpgm
    dgptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdafardlaaa
    gglglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfvyaassqa
    apelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgsalvtalteglprlraltg
    elaagvrl
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6dweE (E:)
    mvaveqseasrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgv
    pysdpgmdgptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdaf
    ardlaaagglglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfv
    yaastmgvtgardavsqaapelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgs
    alvtalteglprlraltgelaagvrlgmsahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dweE (E:)
    asrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgvpysdpgmd
    gptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdafardlaaag
    glglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfvyaassqaa
    pelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgsalvtalteglprlraltge
    laagvr
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6dweG (G:)
    mvaveqseasrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgv
    pysdpgmdgptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdaf
    ardlaaagglglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfv
    yaastmgvtgardavsqaapelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgs
    alvtalteglprlraltgelaagvrlgmsahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dweG (G:)
    asrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgvpysdpgmd
    gptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdafardlaaag
    glglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfvyaassqaa
    pelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgsalvtalteglprlraltge
    laagvrlg
    

  • Chain 'H':
    No sequence available.